home tour in dubai

• Latest projects
• All Projects
• Destinations

Mudon Al Ranim 7

Mudon Al Ranim 5

Mudon Al Ranim 4

Mudon Al Ranim 3

Dubai Properties

Dubai Holding Real Estate

Community Management

Virtual tours, let us take you on a virtual tour.

Explore our stunning properties in UAE from the comfort of your home and decide which ones suit your taste the best.

Mudon Views

With beautiful views onto the lush green Mudon Central Park and many ways to stay active, Mudon views is perfectly situated for a vibrant, f...

Living amidst nature yet having all modern day lifestyle facilities and amenities-now that’s an ideal home. The Remraam community offers a c...

Welcome to La Rosa II, where our spacious 3, & 4 bedroom townhouses will bring back the joy of family reunions within the most serene settin...

Dubai Properties remit includes the management of investor relations for land lease and sale, providing a framework for regulating investor activities as well as enhancing and managing districts and land assets in DUBAILAND and Business Bay. Dubai Properties Group's land plots situated in DUBAILAND and Business Bay may be used for projects including but not restricted to schools, community centres, residential buildings, office towers, hotels, retail outlets and medical facilities. Interested investors are invited to contact us using the form below.​

REGISTER NOW

• Property details
• Contact Details
• Tell us more

Thank You Your message has been successfully sent.

Dubai 5 Day Itinerary: How To Spend 5 Days In Dubai

Some posts on this site contain affiliate links, meaning if you book or buy something through one of these links, I may earn a small commission. Read the full disclosure policy  here .

Dubai 5 Day Itinerary

Have you been dreaming of a trip to Dubai? My Dubai 5 Day Itinerary will help you to work out what to see and do in this exciting UAE city. Dubai is one of the most exciting and diverse destinations in the world. The city has something to offer everyone, from luxury shopping and fine dining to adventurous desert safaris and world-class sightseeing. Planning a trip to Dubai can be overwhelming, so I’ve put together this ultimate Dubai 5 day itinerary to help you make the most of your time in this amazing city. Whether you’re looking for a luxurious escape, an adventurous getaway, or a cultural journey, this itinerary has you covered!

Table of Contents

About Dubai

Once a humble fishing village along the edge of the Arabian Desert, Dubai has undergone a remarkable transformation into a global metropolis and a hub of commerce, tourism, and innovation.

Fuelled by its strategic location and oil wealth, the city has catapulted itself onto the world stage with ambitious projects like the world’s tallest building and sprawling artificial islands. Today, Dubai stands as a testament to visionary urban development, blending its Bedouin heritage with an ultramodern lifestyle that attracts people from all corners of the globe.

Dubai is a city of superlatives that promises an unforgettable travel experience.

Known for its breath-taking skyline dominated by towering skyscrapers like the Burj Khalifa, the world’s tallest building, Dubai is a fusion of futuristic innovation and deep-rooted cultural heritage.

From the golden sands of its expansive deserts to the luxurious allure of its shopping malls and the vibrant tapestry of its cultural districts, Dubai offers a wide range of attractions for every kind of traveller.

Whether you want to go skydiving over Palm Jumeirah (yes that’s possible), or enjoy the serenity of a sunset dhow cruise along Dubai Creek, Dubai is a destination that not only meets expectations but exceeds them in spectacular fashion.

Introduction: What to Do in Dubai for 5 Days

Dubai is a city that offers something for everyone. But with so many things to do in Dubai, how do you know where to start?

In my opinion, formed from about 6 visits to Dubai and the UAE , 5 days is the perfect time frame to see everything that Dubai has to offer and not be too rushed in the process.

This 5-day itinerary is designed to provide a comprehensive overview of the best things to do in Dubai for a week. From luxurious spas and world-class sightseeing to exciting desert safaris and shopping tours, this itinerary will help you make the most of your time in this incredible city.

Day 1: Dubai Itinerary

Morning day 1.

After your incoming flight, you will probably want to start your day with no pressure. With this in mind, I’ve left the morning free. Any of the Day 1 activities can be moved up if you are a morning person. If you are a shopper and know you will spend at least a few hours in Dubai Mall, it might be best to start early!

Afternoon Day 1: Burj Khalifa, Dubai Mall And Burj Khalifa Fountain

Head to the world-famous Burj Khalifa . At 2,717 feet (828 meters) tall, the Burj Khalifa is the tallest building in the world, and it offers spectacular views of the city. Tickets are a must and I would recommend booking well in advance to secure your preferred time slot.

Allow 2-3 hours for the Burj Khalifa visit. While you might not need this time, there can be queues not just for the elevators but also for the best photo spots.

Tickets for Burj Khalifa

After you have visited the Burj Khalifa, you are free to explore Dubai Mall and shop until you drop. The mall is massive and while it is home to many luxury brands there are also many more affordable options for shopping.

After you have all your shopping done, head out to take part in your Burj Lake boat tour and fountain show. The times of the boat tour like up with the times of the water fountain show so you can choose time slots between 5:45pm and 10:30pm.

Tickets for Burj Lake Ride

Tickets should be purchased in advance because they also sell out quickly. Grab them e arly to avoid disappointment.

POSSIBLE EDITS FOR THIS DAY

If you would prefer, you could swap the Burj Khalifa and Dubai Mall to visit the mall first. The ticket office for the Burj Khalifa is inside the mall so if you would prefer an evening or night visit to the tower, just visit the mall first.

Evening Day 1: Dinner At Dubai Mall

There are many dining options at Dubai Mall so considering its your first night out, this is a great place to eat.

They have everything from cafe’s to fine dining and I’m sure you will find something to suit your taste and budget.

Check out Dubai Mall’s dining pag e for the list of all the options available to you. If you are after something lighter try Charleys Philly Steaks or one of my favourites Gia , which is an Italian restaurant on the ground floor. Just remember to book Gia if you want to view the fountains. They will book you a table looking out over the fountain but they aren’t always available at the last minute.

Day 2: Dubai Itinerary

Morning day 2: half day desert safari and falcon experience.

On day two, it’s time to head out of the city and into the desert. Experience the thrill of a lifetime with a desert safari, complete with dune bashing, a camel ride or even a stunning hot air balloon ride.

You’ll also get the chance to experience traditional falconry, a popular activity among the Bedouins of the area. If you choose an afternoon option, after your desert adventure, you can relax and enjoy a traditional dinner at a Bedouin-style camp in the desert.

There are heaps of desert experiences on offer in the UAE, however I can highly recommend an early morning Balloon flight . It is an early start for sure, but it is a once in a lifetime experience, especially if you choose the option that enables you to do a camel ride and learn about the falcon masters.

Tours for a Desert Trip and Falcon Experience

If you decide that the early morning trip is not for you, any tour you choose will probably take most of the day. By the time you are picked up, do the tour and return to your hotel, you will find that most of the day is gone.

I would recommend not planning any other tours on this day just to be sure you don’t miss your second pickup time.

Afternoon Day 2:

After your early morning balloon flight (if you choose this option), you can enjoy an afternoon of RnR around your hotel’s pool. Don’t discount the value of spending a few hours resting as Dubai can get really hot and is known to sap your energy if you aren’t careful.

You might like to go in the afternoon and do a camel ride before having dinner at Al Khayma Camp . This will give you the morning to relax and still enable you to have a great desert experience.

Evening Day 2: Walk Dubai Water Canal

Dubai Water Canal walk is a lovely way to wander along the waterway and see the skyline of Dubai. The walk is able to be done from either side of the canal and is either 3.2 or 6.4km depending on if you walk both sides or just one.

There are multiple foot bridges to cross the canal and boats are always up and down the river enabling you to jump on and cross if you wish.

If you start at Al Habtoor Cit y end you can walk the canal to Jumeirah. Alternatively if you start out at Jumeirah walking back in toward the city will mean you can finish at Al Habtoor City and possibly catch the L a Perle by Dragone show. The best way to describe the show is that it’s very Cirque du Soleil in style.

Prices for La Perle vary depending on the seating category. They start at $70 USD per person, and go up to $220 USD each for VIP seats. You can also book a dinner and show package which is currently priced at $110 USD per person. You get a choice from 4 restaurants in Al Habtoor City which gives you heaps of options. You can choose from World Cut, Le Patio, Il Pastaio or BQ and Babiole.

Prices can be dependant on the restaurant you choose.

POSSIBLE EDITS FOR THIS EVENING

You might like to do a dinner cruise instead of walking the canal yourself. This can be a great way to see the lights of the city while relaxing with a wine or two.

A really cool thing you will experience doing a river cruise is that the fountain on one of the bridges actually senses when a boat is going underneath and turns off! It seems like nothing but its pretty cool.

Day 3: Dubai Itinerary

On day three, it’s time to explore the city’s cultural and historical sites.

Day 3: Dubai Sightseeing Tour – Dubai Creek, Old Dubai, The Gold Souk and other sites

Start the day with a sightseeing tour of Dubai, where you’ll get to see some of the city’s most iconic landmarks. There are many tours that showcase Old Dubai including the Gold Souk, which is a must visit for sure. It is a traditional market where you can find a wide selection of jewellery, from traditional designs to modern pieces.

Most of these tours will include visits to many other Dubai locations like the Dubai Frame, Zabeel Palace, The Harbour and of course the Burj Al Arab.

This tour is the one that we did last time and I was really happy with it. Availability is shown below:

Alternatively there are many walking tours of Old Dubai, the creek and the souks. If you have the time they are really worth it.

Walking Tours Of Old Dubai

Meet Jenny, a passionate Australian travel blogger who has explored 103 countries to date. With over 30 years of travel experience, Jenny has a wealth of knowledge to share with her readers about the cultures, landscapes, and people she has encountered on her journeys. She’s always battling unfashionably frizzy hair and you will never catch Jenny in anything but comfortable shoes. Learn more about Jenny and her travels.

Day 4: Dubai Itinerary

On day 4 it is time to take to the water. Whether you do a luxury cruise and see Dubai from the water or whether you simply do a speed boat tour, spending time on the water is a great way to spend a day in Dubai.

You are able to do cruises from just an hour to a full day, with many offering either lunch or dinner as part of the package.

Day 4: Morning or Afternoon Jet Ski, Luxury Cruise or Speed Boat Tour

This speedboat option is only 1-2 hours which will give you time to spend at the beach or participate in another water based adventure.

Rigid inflatable boats pick you up and take you out of the marina cruising the Dubai coastline. You get to see Palm Jumeirah, the Atlantis Hotel, The Burj Al Arab and all the hotels that line this strip of beach.

Dubai Speed Boat Tour

Check availability for this 2 hour speed boat tour from Dubai Marina.

Dubai Jet Ski Tour

As an alternative you could do a 1-Hour Royal Atlantis Jet Ski Tour. There are many companies that do Jet Ski tours in Dubai so you have options with regards to price and time frames.

Dubai Luxury Boat Tour

Finally, there is also the option to do a luxury boat tour. These trips are typically longer than the Jet Ski or Speedboat trips but are way more casual and no effort is required on your part.

Options include boats with slides and water toys that are more focused on a fun day on the water. Or there are more luxury vessels that offer a calmer cruising day with a BBQ lunch as an add on.

POSSIBLE EDITS FOR TODAY

If you wanted to spend less time in the water but have a more thrilling adventure, consider the fly boarding or the wake boarding. Alternatively to get out into the ocean and have a snorkel, check out the Musandam full day from Dubai.

Day 4: Evening and Dinner

Its time to get high above Dubai!

Why not have a Dinner In The Sky while you are in Dubai? This unique dining perspective is pretty interesting and not for the faint hearted. Book early to avoid missing out! Starting at around $200 USD this could be the perfect place to wind up your 5 day Dubai Itinerary.

Day 5: Dubai Itinerary

On your last day for our 5 day itinerary Dubai, it’s time to indulge in some rest and relaxation. Start the day with a luxury spa experience at one of Dubai’s world-class spas. Enjoy a massage, facial, or body treatment and feel your worries melt away. Afterward, you can take a leisurely stroll along the Dubai Creek or take a boat ride to enjoy the sunset.

Day 5: Have an Indulgent Spa Day

Dubai is the place to spend a full day kicking back in a luxury spa. There are many choices of spa styles and locations so you will be able to find something to suit you for sure.

Book A Spa Day In Dubai

If you are up for a beach day instead of a spa, consider booking this amazing trip out to Lebanon in Dubai’s “World Islands” chain and spending the day sunbaking and relaxing in the pristine beaches and ocean.

This tour includes return transfers to and from Jumeirah and you could get to be one of the first people you know to spend a day on a man made island in the bay of Dubai!

Tips for Visiting Dubai

Before you head off for your trip to Dubai, there are a few things you should know. Firstly, it’s important to remember that Dubai is a Muslim city, so it’s important to dress modestly and respect local customs.

Secondly, the city is very hot and humid during the summer months, so it’s important to stay hydrated and make sure you have plenty of sunscreen.

My third tip for visiting Dubai is to make sure you get enough down time. There is so much to do in the city but it’s always warm and its easy to get very tired. Make sure you allocate a few hours each day to get some rest in. If you don’t you will find yourself tired and cranky in no time.

My fourth tip would be to make sure you secure your Dubai eVisa before you head off to Dubai. Whether you’re eligible for a visa on arrival or not, trust me, getting your visa sorted in advance guarantees a smooth entry without any hassle. the best part is, you can easily apply for a Dubai eVisa from the comfort of your own home through trusted via agencies like UAEVisaOnline.ae

Finally, make sure to take advantage of the city’s many free attractions, such as the Dubai Fountain and the Dubai Creek.

Accommodation in Dubai

When it comes to accommodation, Dubai has something to suit every budget and taste. From luxurious 5-star resorts to budget-friendly hotels, the city has something to suit every traveler. Popular luxury resorts include the Burj Al Arab and the Atlantis The Palm, while budget-friendly hotels include the Rove La Mer Beach Hote l , Jumeirah and the Occidental Al Jaddaf in Dubai City.

My personal favourite is the Meydan Hotel. We LOVE that place. It is actually the hotel at the race course in Dubai, however as long as you book outside of race days it can be really affordable and is a beautiful hotel. Read my review of the Meydan Hotel or book via Booking.com .

You used to be able to get it on sale for as little as $220 AUD per night but those pre-covid prices are long gone. On average its around $285 USD per night so its not super cheap but the breakfast is amazing, the staff are super attentive and the pool is DIVINE!

Check Prices

Getting Around Dubai

Exploring Dubai efficiently over 5 days requires a mix of transportation methods due to its sprawling layout and diverse attractions. Here’s a guide to getting around Dubai for your vacation:

• Metro : Dubai’s metro is efficient, affordable, and connects major attractions. It’s ideal for long distances and avoiding traffic. Key spots like the Dubai Mall, Burj Khalifa, and the Marina are easily accessible by metro.
• Taxis : For convenience and comfort, taxis are a great option. They’re reasonably priced and available everywhere. They’re especially useful for destinations not directly served by the metro, or over the summer months when walking in the heat is just not possible.
• Tram and Monorail : Use the tram for areas around the Marina and JBR. The monorail is the only way to reach Atlantis the Palm by public transport and offers great views.
• Buses : Buses are a cost-effective way to travel, although they can be slower due to traffic. They cover areas not accessible by the metro and will give you a much more local experience.
• Rental Car : If you’re comfortable driving in a new city, renting a car offers flexibility. It’s particularly useful for day trips outside the city, like to Abu Dhabi or the desert. I wouldn’t personally hire a car in Dubai. The parking isn’t cheap and to be honest you can get everywhere you need to go easily so I think it is money you just don’t need to spend.
• Walking : In cooler months, walking is pleasant in pedestrian-friendly areas like Dubai Marina, JBR, and the historic Al Fahidi neighborhood.
• Abra (Water Taxi) : For a traditional experience, use an Abra to cross Dubai Creek between Deira and Bur Dubai.
• Hop-On Hop-Off Bus Tours : These tours offer a good overview of the city with the flexibility to explore major sights at your own pace. These are often my personal favourite. Buy a 2 day (or 48 hour) Dubai Hop On Hop Off Bus Pas s and use it for the 2 days you wish to be on the go and seeing a lot of the sights.

Other Dubai Attractions You Might Like to Visit

You could insert any of these Dubai attractions into your itinerary at any point. Dubai has so much to see and do that you could stay for weeks and not experience everything this great UAE city has to offer.

Book your ski pass her e for Dubai’s indoor ski park.

Burj Al Arab

Spend an afternoon at Burj Al Arab Terrace poolside. Aprox $215 USD M~Th and $270 USD F~S with half of that credit against food and bev.

Mall Of The Emirates

Another great shopping centre, Mall Of The Emirates has shops, restaurants and a cinema.

Skydive Dubai

Feeling care free? Why not skydive while you are in Dubai? Check out Skydive Dubai for options. OR: be brave abd get your first lesson on a Gyrocopter !

Wild Wadi Waterpark

If you fancy a day having fun at the waterpark, check out W ild Wadi . You might also consider Atlantis Aquaventure Waterpark on The Palm.

Topgolf Dubai

Practice your shots at Topgolf Dubai !

Wrapping Up: 5 Day Itinerary for Dubai

Dubai is a bustling city with something to offer everyone. From world-class shopping and fine dining to desert safaris and traditional souks, you’ll never run out of things to do in this amazing city.

This 5-day itinerary is designed to help you make the most of your time in Dubai, from luxurious spas and sightseeing tours to shopping trips and desert safaris. So what are you waiting for? Start planning your Dubai adventure today!

You won’t regret it!

More UAE Posts

5 Emirates To Visit In The UAE that AREN’T Abu Dhabi or Dubai Why the UAE is a great place to travel solo

Share With Your Friends

Explore perth: a comprehensive travel guide to west australia’s capital city, is the maldives worth the cost, 3 thoughts on “dubai 5 day itinerary: how to spend 5 days in dubai”.

Really loving this itinerary, ChargeTheGlobe! The mix of high-energy activities like jet skiing and the more chill desert safari is spot on for a place like Dubai. Just wondering, for the Dubai Luxury Boat Tour, are there options for food on board? Hoping to catch a sunset dinner if that’s a thing!

SkyeWalker22, I had the same question! Last time I was in Dubai, I missed out on the boat tours and definitely don’t wanna make that mistake again. If anyone’s got the scoop, would love to hear more about it.

Was reading about the Burj Khalifa Lake ride, sounds like a must-do. Do you know if there’s any tech or AR experiences included? Saw something about VR tours around Dubai, and mixing that with real sightseeing could be epic.

Comments are closed.

7 Days in Dubai: Perfect Itinerary for First Trip (+Map & Tips)

By Author Jurga

Posted on Last updated: October 18, 2024

Visiting Dubai in the United Arab Emirates for the first time and wondering how to plan your trip so that you can see most of the top sights in Dubai in a week or less? What are the ‘must-sees’ and how to plan your time so that you can make the most out of your trip, no matter the duration?

In this guide, we share  a recommended Dubai itinerary for 7 days.  Our suggested itinerary is described below in detail, day per day, and in such a way that it’s actually doable taking into account travel- and visit times, and without having to run all the time. Plus, we include tips on how to adjust this itinerary if your trip is shorter than a week.

We also share a map of all the top sights and attractions as well as our experience-based tips to help you with the practical side of planning a trip (such as where to stay or which tickets to pre-book in order to avoid disappointment).

Top 4 Tickets & Experiences to Book in Advance:

• Burj Khalifa (we recommend tickets incl. 148th floor – it’s worth it!)
• Museum of the Future

Desert Safari

• Abu Dhabi Day Tour

PRO TIP: To save money, you can also book some of the most popular Dubai attractions together with this Explorer Pass . You can choose 3-7 attractions from a huge list, including all the top sights, theme parks, desert safari tours, etc.

Good to know: Don’t worry if your trip to Dubai is shorter than 7 days. You can easily adjust this itinerary based on your interests and the time that you have. Simply start with days 1-2-3 since the main sights are covered in those days and work your way down the list.

If you are visiting Dubai in cooler months (= peak season), make sure to   book your accommodation and activities well in advance! Click here for traveler’s favorite hotels in Dubai .

Dubai Itinerary Overview & Map

Here is our recommended one-week Dubai itinerary in a nutshell as well as the map indicating all the top sights mentioned in our article.

Further below, you can find all the details with more info, tips, and lots of photos. It will give you a better idea of what to expect and how to plan your time so that you can see the very best of Dubai in a week or less.

This is our recommended 7-day itinerary for your first trip to Dubai:

• DAY 1: Downtown Dubai (Burj Khalifa) + Museum of the Future
• DAY 2: Old Dubai + Desert Tour
• DAY 3: Burj Al Arab, The Palm, Marina
• DAY 4: Abu Dhabi Day Trip
• DAY 5: Dubai Miracle Garden + Global Village or IMG Worlds of Adventure
• DAY 6: Waterpark (or an alternative day trip)
• DAY 7: Dubai Frame + AYA Universe + iFly Dubai

Good to know: In this itinerary, we grouped the best places to see in Dubai and top activities based on their location and the time that you need in order to visit them and to travel in between.

Traffic can be really busy, so it’s important to keep that in mind when planning your sightseeing and excursions! For more info, be sure to also read our Dubai travel tips .

How to use this map:  Use your computer mouse (or fingers) to zoom in or out. Click on the icons to get more information about each place. Click the arrow on the top left corner for the index. Click the star next to the map’s title to add it to your Google Maps account. To view the saved map on your smartphone or PC, open Google Maps, click the menu and go to ‘Your Places’/’Maps’. If you want to print the map or see it in a bigger window, click on ‘View larger map’ in the top right corner.

Practical Info & Planning Tips

Here is some essential information to help to plan your trip to Dubai:

Where to Stay

• For a short trip to Dubai with sightseeing as the main focus, stay close to Dubai Mall (e.g. Sofitel Dubai Downtown ).
• If you are staying for a week or longer, consider the Dubai Marina area (e.g. JW Marriott Hotel Marina ) or Jumeirah Beach Residence (JBR) near the Marina (e.g. Sofitel Dubai Jumeirah Beach ).

Our experience: We like to stay on the beach when visiting Dubai, especially for a longer vacation. Once we stayed at Doubletree by Hilton JBR Beach , and recently we stayed at Rove La Mer Beach Hotel which is not just at the beach, but also close to the Dubai Mall area. This area is still under development but has a very hip and relaxed feel.

TIP: Staying by the sea, allows you to combine sightseeing with relaxing beach holidays – the best of both worlds!

Getting Around

The cheapest and fastest way to cover big distances in Dubai is the metro. However, depending on where you are staying/going, a taxi is a very good and affordable option as well. See our guide to Dubai public transport for more info.

Renting a car is quite affordable, but parking can be a real hassle in Dubai. Plus, most guided tours include pick-up and drop-off at your accommodation, so renting a car is not a must.

READ ALSO: What to Wear in Dubai

Tickets and Tours

If you wonder whether you need to pre-book anything/everything, my advice is simple: if you don’t want to miss it, be sure to book it in advance. On a recent trip, we couldn’t get quite a few tickets because we planned it all last minute. Luckily, this wasn’t our first visit and we had visited most of those places before.

Tickets to the most popular attractions in Dubai often sell out, some even weeks upfront. And even if you can get them on the spot, they are usually (a lot) more expensive than online. For tours, it depends. Usually, you should be able to book last minute, but if you find a tour you like, just reserve it.

Good to know: Most of the attraction tickets and tours we recommend can be booked via the GetYourGuide website which offers very flexible cancelation so you have nothing to lose. This is the website we personally used for all our tickets and tours in Dubai. In our detailed day-to-day itinerary below, you can find more information about tickets and tours that we recommend.

Please note that all the hours in our itinerary are only indicated for your reference so that you have a better idea of how much time approximately you need everywhere. Don’t forget to foresee plenty of buffer time between the attractions that work with timed entry slots!

READ ALSO: Best Tours in Dubai (our hand-picked selection!)

How to Plan Your Itinerary?

Our recommended itinerary below is for up to one week in Dubai. If your trip is shorter and you have less than a week in Dubai, you can simply adjust our recommended itinerary based on your interests and the time that you have.

To make it easier to decide what to see, we listed the very best places and top attractions first . So for example, with three days in Dubai, follow the itinerary described on days 1, 2, and 3. With 5 days in Dubai, follow the recommendations for the first 5 days, etc.

Of course, you can also ‘mix and match’, pick the activities that interest you the most, switch the days around, and plan your own perfect trip. Use this just as inspiration for the top places to see and what can actually be done in Dubai in a week. And if your trip is shorter, you can also find some suggestions for half a day, a day or two in our guide on planning a stopover in Dubai .

Read on for all the details and our experience-based recommendations for a week in Dubai!

Here is our recommended itinerary for 7 days in Dubai:

Museum of the Future – Sky Views Observatory – Dubai Mall – Burj Khalifa – Dubai Fountains.

Day 1 – planning info/tickets to book:

• Museum of the Future – timed entry tickets (book at least a few weeks in advance!).
• Sky Views – timed entry tickets or tickets + Edge Walk .
• Burj Khalifa – timed entry tickets (book well in advance!).
• Optional: Burj Lake boat ride and/or Dubai Aquarium .

Good to know: Some of these attractions can also be booked together, as a combo deal. For example, Burj Khalifa + Dubai Aquarium ticket can save you about $20 per person. You can find more options and bundle deals here .

Here’s what your first day in Dubai could look like:

Museum of The Future

9.30 – 11.30 AM.

Start your day with one of the most popular attractions in Dubai – the Museum of the Future . The iconic building is one of the most remarkable landmarks of Dubai and the museum is the most sought-after ticket in the UAE.

A visit to this museum gives you a peek into the future of space travel and climate change, but also health, robotics, and AI. With lots of interactive displays, it’s an interesting place that the whole family will enjoy. But frankly, a lot depends on your expectations – some people love it, others say it’s over-hyped. Either way, it’s worth visiting even if just for the remarkable architecture.

PRO TIP: Book your tickets for this museum well in advance. They are usually sold out at least 2-3 weeks upfront. In addition, if you want to be able to pick a time slot as well, you really should book at least a month in advance. Below, you can insert your travel dates and immediately see if/what’s still available.

If needed, adjust your Dubai itinerary so that you can visit this museum on another day.

Practical info: The museum is open from early morning and you will need a couple of hours for a visit. So ideally you start your day here and keep the afternoon for the Dubai Mall area. Booking the first time slot is also the best way to enjoy the exhibits without a big crowd!

12 – 1.30 PM

Next, take a metro to Dubai Mall. It’s just two metro stops from the Museum of the Future and as you exit the station, you’ll be right at the next place we recommend visiting – Sky Views. Alternatively, you can also take a taxi, just be sure to ask them to drop you off at the right place depending on what you decide to visit first (the Dubai Mall area is huge!).

Sky Views is an observatory at 720 ft (219.5 meters), offering some of the best 360° views of Downtown Dubai. From here, you have an unparalleled view of the iconic Burj Khalifa, which is located just nearby but also at a nice distance to admire it to the fullest.

In addition to the viewing platform, there is also a glass-bottom walkway , a bit like at Dubai Frame (more about it on day 7 of this itinerary).

Plus, all tickets include one go on the Sky Glass Slide , a short transparent tube that ‘floats’ at the side of the building. Don’t worry – it’s not nearly as exciting as it sounds, and frankly, I’m still not sure if I would queue for it for almost an hour again… But if it’s not too busy, be sure to give it a try. It’s fun!

Good to know: At an additional cost, you can get a ticket that includes the Sky Edge Walk . Attached with a harness, you walk on an open platform on the 52nd floor. This looks so cool and could easily become one of the best experiences you do in Dubai.

Since one of our kids has a serious fear of heights, I couldn’t try the Sky Edge yet (on the most recent trip, I was in Dubai alone with the children, so hanging on the side of a building while the kids waited inside wasn’t really an option ;)). But if you are up for it, give it a try – it looks amazing and everyone we talked to who did it was very enthusiastic.

Talking about heights, the same kid was totally ok with the glass slide, but he wouldn’t step on a glass-bottom walkway… Go figure…

TIP: Book timed-entry tickets in advance, even more so if you are interested in the Sky Edge Walk option!

Practical information: To be on the safe side, give yourself at least half an hour to get to Sky Views Observatory from the Museum of the Future. The metro ride is just 3 minutes, but you also need to walk to the metro and find your way around the Dubai Mall station, etc.

AFTERNOON + EVENING.

Next, time to visit the famous Dubai Mall . Inside, you will find plenty of places for lunch . From fine dining options and pricier restaurants overlooking Dubai Fountains to lower-budget fast-food chains, the choice is overwhelming.

The entrance to Burj Khalifa is also located here, at the lower level of the Mall. Depending on your preference for daytime or nighttime views and/or which time slot you can get for Burj Khalifa (more info below), you can explore the Dubai Mall first or after visiting the tower.

The Dubai Mall complex is so huge and has so much to offer that you could easily spend an entire day and still not see part of it! In addition to hundreds of stores and restaurants, you will also find all kinds of family-friendly attractions here, including an indoor ice skating rink, KidZania , MirrorMaze, cinemas, indoor playgrounds, and many others.

TIP: Do not miss the Dubai Mall Waterfall and Dubai Aquarium. Both can be admired for free, but if you want to visit the aquarium inside, you’ll need a ticket (and it’s really expensive for what it is and even more so if you didn’t think to get your tickets online…). So if you want to visit here, consider this combo ticket with Burj Khalifa (and book in advance!).

Good to know: Dubai Mall is huge and overwhelming for a first-time visitor. There are multiple levels, interconnected with countless staircases and elevators, plus multiple entrances and exits. So foresee plenty of time for everything and don’t plan too many attractions on the same day. Or do the things you absolutely want to do first and then see if you still have time and energy left for the rest.

Burj Khalifa

The highest building in the world, Burj Khalifa is the most popular tourist attraction in Dubai. While you can admire this iconic building from outside as much as you like, you will need a ticket to visit the ‘At the Top’ experience.

There are several options for which levels you can visit, and ticket prices vary depending on that, but also on the time of the day when you come.

The standard ticket includes levels 124 and 125 and gives you access to unparalleled 360° views over Dubai and the Arabian Gulf. You can also opt for this ticket that includes levels 124 and 125 as well as lunch or dinner at Rooftop, The Burj Club.

PRO TIP: We recommend getting this ticket that includes access to SKY Level 148 (in addition to standard levels). This ticket also gives you priority access to security and the elevator, which will save you a lot of time and stress. That’s worth a higher price in itself. It also includes an introductory tour with a guest ambassador and access to the lounge with snacks and hot drinks (except during the daytime in the month of Ramadan).

Insert your travel dates below to check what’s still available and don’t wait to book! The best time slots sell out days and sometimes weeks in advance!

Practical information: The busiest and most expensive time to visit Burj Khalifa is ‘around’ sunset, which in practice means the entire late afternoon.

For example, if the sunset is at 6.30 PM, ticket prices are higher between 3 PM and sunset time… But if you only enter at 6.30, the sun will long be gone by the time you get to the top, so I see no point in paying more for the time slots that are too close to the actual sunset time…

TIP: If you want to enjoy daytime views, the sunset, and night views, book a time slot about 1.5-2 hours before the sunset. That way, you should be able to get to the top in time, even if there are long queues. Alternatively, as already said before, get priority tickets which will save you a lot of queueing.

Dubai Fountains & Burj Lake Boat Ride

+-15-30 MINUTES.

No trip to Dubai would be complete without seeing the famous Dubai Fountains show at Burj Lake . You can find these fountains outside of the Dubai Mall, at the foot of Burj Khalifa.

While this area is always nice to explore and walk around, the best time to be here is in the evening, when you can see a musical show and the fountains dancing with the backdrop of Burj Khalifa.

The fountain schedule is as follows: daily at 1 PM and 1.30 PM, plus every 30 minutes from 6 PM to 11 PM. On Fridays, there is no show at 1 PM, but there is one at 2 PM. The shows are always slightly different and if you come here in the evening, you’ll likely catch a few of them.

TIP: In addition to seeing the fountains from land, you can also opt for a short scenic boat ride on Burj Lake . These boats also give you a front-row seat during a fountain show.

It looks like a very touristy activity (just like everything in Dubai ;)), but the kids wanted to do it on our recent trip and we all enjoyed it more than I expected. It’s very affordable for Dubai standards and we all found that it was well worth it. It’s also a nice way to rest your legs a bit after all the sightseeing.

Spend the rest of your day/evening in the Dubai Mall area. Afterward, take a metro or a taxi back to your hotel.

Good to know: The taxi and Uber stands at the Dubai Mall are located at one of the underground levels, quite far from the Dubai Fountains, and are very confusing to find (plus, the taxi stand is not the same as the one for Uber).

So if you want to call it a day after visiting the fountains, simply walk to any public road on either side of Burj Lake and call a taxi from there – it’s so much easier! For example, there is a taxi drop-off point on the main road behind the Dubai Opera.

Al Fahidi Historical Neighborhood – Dubai Creek – Traditional Souks – Dubai Desert.

Day 2 – planning info/tickets to book:

• Old Dubai – we recommend visiting with a guided tour .
• Dubai Desert tour – there are many options including various activities .

When you think of Dubai, you probably associate it with skyscrapers and all the iconic modern-day landmarks. However, no trip to Dubai would be complete without exploring its old town and the desert.

So on your second day, we recommend that you spend some time getting to know the more traditional side of Dubai.

Here is what your day could look like:

9.30 AM – 12.30 PM.

In the morning, take a couple of hours to explore the Old Dubai.

Start at the nicely restored Al Fahidi Historical Neighborhood . Here, you can find several low-key museums and a few traditional restaurants, but the best thing to do is simply walk around the area. Here, you will find a completely different Dubai, as it used to look in the not-so-distant past.

Afterward, take a ride on a traditional Abra boat to the northern side of Dubai Creek. Here, you will find the two most popular traditional markets in Dubai: the Spice Souk and Gold Souk .

TIP: We recommend visiting this area with a local guide . Not only because it’s easier and you don’t need to plan anything, but it’s also a nice way to get to know more about the history of the UAE and learn about local traditions and customs. Plus, you can get some tips for haggling at the markets.

Good to know: There are many tours that visit the Old Town. They all cover pretty much the same places, including the boat ride. Most tours take about 3 hours, are very affordable, and have great reviews. The main difference is that some of them include some/more local food and drinks.

Frankly, it’s really hard to choose a tour. I wasted hours reading descriptions and reviews and was still none the wiser… So save yourself the trouble and just pick any highly-rated tour that suits your itinerary and you should be fine.

In the end, we chose this guided tour because it includes quite a lot of local food at one of the best traditional restaurants (in addition to the markets and other sights that all tours visit). But if you are less interested in food and more in the area, you can find plenty of cheaper tours as well. Most of them include at least one local snack too.

On our first visit to Dubai many years ago, we opted for a bit longer city tour that included a few other areas as well. The old town part of both these tours was very similar.

After visiting the old town, get back to your hotel and take some time to relax and enjoy the pool. Depending on the location of your hotel, which desert tour you booked, and the pick-up time for the tour, you should have a couple of hours of free time.

Good to know: When booking a tour that includes a pick-up/drop-off at your accommodation, keep in mind, that they will usually pick you up about 30-45 minutes before the official starting time. If you book tours online, they will usually reach out to you via WhatsApp either the evening before or in the morning.

TIP: Don’t eat too much for lunch if you book a desert tour that includes a BBQ dinner. There is so much food on these tours (and it’s delicious) – you won’t be hungry. Plus, if you opt for a dune-bashing in a jeep, it’s better that you haven’t eaten too much just before that…

3 – 10 PM.

A visit to the desert is another experience that should be in any Dubai itinerary. No matter which tour you choose, you are in for a good time, but be sure to read tour descriptions so that you know what exactly to expect!

There are  many desert tour options , either about 4 or 7 hours. Unless you want to go on a hot air balloon (in which case it will likely be in the morning), we recommend looking into afternoon/evening tours that include a BBQ dinner.

On these longer tours, there is usually one main activity, such as a 4×4 dune safari in a jeep, a quad bike ride, or a camel ride. The rest of the time is spent in a Bedouin camp where you can find all kinds of different experiences (sandboarding, taking pictures with falcons or camels, traditional dance shows, henna painting, etc.) which are all included with the tour.

The food on these tours is usually very good and plentiful. Water is included and most of the time, soft drinks and local warm beverages are included as well.

Our experience:  We have been on two different desert tours in Dubai (on different trips). They were both evening tours including dinner, had very similar itineraries, and were both very good. The main activity on  the first tour we did was dune bashing in a jeep. Other activities included sandboarding, a very short camel ride, a traditional Tanoura dance show, etc.

On a recent trip, we opted for  this highly-rated tour . The main activity this time was a 45-minute camel ride. Other activities included taking pictures with falcons, henna tattoos, shisha pipe, traditional dance shows, a fire show, etc.

Good to know: Just like with the old town tours, there are so many desert tour options that it can be overwhelming to pick one. First, decide what you want to do – for example, quad biking , a camel ride , etc. Then, read the description so that you know what’s included. For example, many tours include a short camel ride (for a picture), but only very few do a longer trek through the desert.

In general, all these tours are quite similar, and – at least in our experience – very good. Just be sure you know what you are booking so that you don’t end up on a quad bike while you were expecting to sit on a camel…

Burj Al Arab – Souk Madinat Jumeirah – The Palm – JBR Beach – Dubai Marina.

Day 3 – some ideas for activities on this day:

• Inside tour or a Royal Suites tour + gold cappuccino .
• The View at The Palm Observatory
• Sightseeing Helicopter Ride
• Luxury Yacht Sightseeing Tour .
• Zip Line Across Marina .
• Marina E-scooter Tour .

On your third day in Dubai, we recommend visiting the area around Burj Al Arab, The Palm, and Dubai Marina and potentially also the nearby JBR Beach .

If you just walk around without visiting many attractions, then you can easily see all these places in a day. If, however, you opt for any of the activities, you will have to adjust your itinerary depending on the place/time of whatever you decide to do.

There are a lot of attractions that you can choose from on this day, but none of them are ‘must-do’. So a lot depends on your interests and budget. Also, don’t book too many different activities at different locations for the same day, and keep traffic in mind.

Here is what your third day in Dubai could look like:

Burj Al Arab & Souk Madinat Jumeirah

+-10 AM – 1 PM.

The sail-shaped Burj Al Arab is one of the most recognizable landmarks in Dubai. It’s renowned as one of the world’s most luxurious hotels with lavish interiors and extravagant experiences.

You can just see the hotel from the outside, or you can also book a tour of the interior . If you want to get a taste of true luxury, upgrade to this luxury tour which includes their world-famous gold cappuccino and a visit to the 25th floor where you can see the Royal Suites.

Set against the backdrop of the Burj Al Arab, Souk Madinat Jumeirah is a bustling souk with traditional Middle Eastern charm. This area also has some picturesque waterways offering nice views of the Burj Al Arab.

Good to know: Depending on what you decide to do in this area, you can visit both places in about half an hour. If you book one of the tours, you’ll need at least 2 hours. In that case, we recommend booking the earliest tour, at 10 AM, and having lunch at the souk.

+- 1.30 – 3 PM.

The Palm Jumeirah is a man-made island shaped like a giant palm tree. Stretching into the azure waters of the Arabian Gulf, The Palm is connected to the mainland with bridges and tunnels. The island is home to a large number of luxurious hotels and opulent residences.

One of the most famous attractions here is Aquaventure Water Park at Atlantis Hotel, but since you need at least a day for it, we recommend visiting the water park separately – see day 6 of our itinerary.

On this day, I would just focus on sightseeing. The best place to be is The View at The Palm Observatory from where you can enjoy nice 360° views including a good overview of this unique island. Alternatively, for even better aerial views, you can also opt for a sightseeing tour by helicopter .

If you are looking for nice views and want to relax at the pool, you could also check out the Aura Skypool . Keep in mind that no kids are allowed and that you will need to reserve a specific time slot in advance.

Good to know: Also here, the timing will depend on the activities you choose to do. If you just visit The Palm Observatory (and prebook timed entry tickets in advance!), 1 – 1.5 hours should be sufficient. A helicopter tour takes less time and is better organized, but you also need to arrive a bit earlier, etc. so to be on the safe side, I’d plan about an hour as well.

Dubai Marina

LATE AFTERNOON & EVENING.

Next, head to Dubai Marina , just 10 minutes drive from The Palm. Or – if you want to make the most out of your day – visit Jumeirah Beach Residence (JBR Beach) first and then the Marina after that (the two areas are just next to each other).

The JBR – Marina Beach has a very nice waterfront area with access to a public beach and many cafes and restaurants. In the distance, you can also see the Dubai Eye (Ain Dubai), the world’s largest Ferris wheel. However, it’s been closed for years. The area is nice, but since it’s on a separate ‘island’, you would need quite a lot of extra time to visit there.

Dubai Marina is one of the nicest walkable areas to explore in Dubai. There is not one specific place that you ‘must’ see here and the best thing is to simply walk around along the Marina Walk (see our map for details). On the way, you can also visit the Marina Mall . Alternatively, consider joining a guided e-scooter tour – it’s a great way to see a lot of this vast area without having to walk.

In addition, there are quite a lot of activities that you can do at Dubai Marina. The most popular are luxury yacht sightseeing tours . If you are interested in water sports, you can go jet skiing or parasailing . Adrenaline seekers will love the zip line across the Marina …

TIP: Dubai Marina is also very nice in the evening. The atmosphere is great, there are lots of good restaurants, etc. So no matter how you plan this day of your Dubai itinerary, I recommend that you end it at the Marina. Scenic boat cruises in the dark are also really great, offering wonderful night-time views of the Marina skyline.

Good to know: We recommend at least an hour or two for the Marina Walk. In addition, boat tours in this area are really worth your time and some of them can take 2-3 hours. All in all, I would plan a good half a day in this area.

Day 4 – planning info/tickets to book:

• Abu Dhabi day tour – there are tons of options .

No trip to Dubai would be complete without visiting Abu Dhabi , the capital city of the UAE. It’s about 1.5- 2 hours drive from Dubai, so doable as a day trip.

Just to be clear – there is a lot more to see and do in Abu Dhabi than you could possibly see in a day.

Half a day tour is a good option if you are really short on time and just want to visit the main landmark – Sheikh Zayed Grand Mosque.

But with a week in Dubai, you could definitely spare a day. So we recommend taking a full-day tour to Abu Dhabi. That way, you can see several other places and get a much better idea of what Abu Dhabi is like.

Abu Dhabi Day Trip

Our experience: We booked this highly-rated day tour and I can highly recommend it. It’s one of the most complete Abu Dhabi tours I could find.

It includes a visit to the Sheikh Zayed Grand Mosque, Etihad Towers observation deck, and the Royal Palace, Qasr Al Watan.

For more information, the best tour options, and tips for planning a day trip to Abu Dhabi, please see our detailed guide via the link below.

LEARN MORE: Abu Dhabi Day Tour From Dubai

Days 1-4 of our recommended Dubai itinerary include most of the must-sees. But there are quite a few other attractions that are also very popular and considered ‘must do’. However, a lot depends on who you are traveling with, what your interests are, and also on your budget.

Anyway, to help you plan your time, we highlight several of the most popular tourist attractions in Dubai on days 5-7 of this itinerary. We grouped them taking into account their location so that you can make the most out of your time. Take a look below!

Day 5 – planning info/tickets to book:

• Dubai Miracle Garden – ticket .
• Global Village – tickets .
• Optional: Dubai Butterfly Garden .
• Alternative for families: IMG Worlds of Adventure .

Dubai Miracle Garden and Global Village are located very close to each other and can be easily visited on the same day/evening. There are also tours/private transfers that can bring you to both places (in about 6 hours).

Good to know: The Miracle Garden is open from 9 AM until 9 PM (11 PM on weekends) so could be visited at any time. However, Global Village is only open from 4 PM (6 PM during Ramadan) until midnight (1 AM on weekends). Furthermore, Tuesdays are reserved for families and women.

TIP: You could spend a good part of this day at the pool/beach and only do sightseeing in the late afternoon/evening. Or, if you absolutely want to make the most out of your time, you could also visit the Dubai Butterfly Garden which is located just next to Miracle Garden.

Alternatively, families might enjoy a visit to IMG Worlds of Adventure , one of the largest indoor theme parks in the world. The tickets are pricey so if you opt for this, you’ll likely want to spend the whole day here.

Miracle Garden

+- 1-2 HOURS.

Miracle Garden Dubai is a huge floral wonderland with over 150 million flowers. It boasts a breathtaking array of meticulously crafted floral displays, sculptures, castles, and all kinds of structures, all adorned with millions – yes, millions – of blooming flowers.

Some of their sculptures have won various Guinness World Records. You probably already get the vibe in the UAE – everything is big, bigger, the biggest… This impressive garden is no exception. They even have a flowery version of the Emirates A380 airbus, covered in more than 500,000 fresh flowers and plants. 

However, remember that you are in the middle of a desert so it’s difficult to keep most plants alive in a climate like this. That’s probably the reason why the overwhelming majority of flowers are petunias, in just a few different colors.

TIP: Book tickets in advance and count about 1-2 hours for a visit here.

Good to know: The morning hours are the quietest, but if you want to visit Global Village as well, then it’s best to come in the afternoon and visit both places together.

Global Village

+- 3-4 HOURS.

Global Village Dubai offers an immersive cultural experience taking you on a journey ‘around the world’. The name pretty much says it all – it’s a place where you can experience different cultures while exploring pavilions, each representing another country.

Over 90 countries are represented, showcasing their unique heritage, traditions, products, and traditional foods. From sampling diverse cuisines to shopping for handicrafts, clothing, and souvenirs from around the globe, there’s something for everyone. In addition, they also have live performances, cultural shows, carnival rides, etc.

Good to know: Global Village is one of the most affordable attractions in Dubai and regular tickets cost just a few bucks. However, this is just a ticket to get inside and you’ll have to pay extra for most of the attractions – a bit like visiting a country fair. Plan to spend at least 3-4 hours here.

TIP: Global Village is one of the most visited attractions in Dubai, popular with locals as well as international tourists. So avoid weekends and try to be at the entrance a bit before it opens because it quickly fills up. Friday and Saturday evenings can get crazy busy.

Day 6 – planning info/tickets to book:

• Atlantis Aquaventure – various ticket options .
• Wild Wadi – entry ticket .
• Dubai LEGOLAND – water park or theme park .

Alternative ideas for this day:

• Snorkeling day trip to Fujairah .
• Al Ain ‘Garden City’ day trip .
• Half-day camel trekking .
• Half-day falconry safari .

If you have a week in Dubai, we highly recommend visiting at least one of the water parks, especially if you are traveling with children or teenagers and there’s only that much sightseeing they can handle in the hot desert climate.

But no worries if you are not interested in spending a day on water slides, there are tons of other amazing things to do in and near Dubai. In that case, see our alternative suggestions above . For more info about waterparks – see below.

Atlantis Aquaventure Waterpark & Lost Chambers Aquarium

There are several water parks in Dubai. By far the best and most popular is Aquaventure at Atlantis The Palm , the biggest water park in the world. With over 100 rides and attractions, Aquaventure has something to offer for the whole family. You can also meet dolphins and sea lions, and enjoy all kinds of water sports. In addition, you can visit the Lost Chambers Aquarium which is located just near the water park entrance.

Wild Wadi and LEGOLAND Water Park are also nice water parks. They are much smaller, with about 30 rides and attractions at Wild Wadi and about 20 at LEGOLAND.

These water parks are nice for families with younger kids and are incomparably less busy than Aquaventure. But if you want to experience the very best waterpark in Dubai, Aquaventure wins every time.

Good to know: You can spend the entire day at any of these water parks.

PRO TIP: Atlantis Aquaventure tickets are cheaper if booked online and over a week in advance. We recommend a combo ticket that includes entry to the Lost Chambers Aquarium (it’s open late in the evening so you can easily visit after you leave the water park).

For more tips and helpful information for your visit, see our detailed guide via the link below.

LEARN MORE: Tips & Tricks for Visiting Atlantis Aquaventure

Day 7 – planning info/tickets to book:

• Dubai Frame – timed-entry tickets .
• AYA Universe – timed-entry tickets .
• Optional: iFly Dubai and/or Green Planet Indoor Rainforest .

On the last day of this itinerary, I want to highlight some additional experiences that we personally really enjoyed on a recent trip to Dubai. They are located not too far from each other in the northern part of the city (not too far from the airport) and could be done on the same day.

If you want to take it easy on your last day in Dubai, you could also just visit one or two of these attractions and spend the rest of the time chilling by the pool.

The two places that we recommend the most are Dubai Frame and AYA Universe. Our kids also LOVED iFly Dubai , but it’s located quite a bit further away and is probably also not for everyone’s interests. The Green Planet indoor rainforest is also amazing (and definitely not just for kids). You can find more info about each of these below.

Dubai Frame

The Dubai Frame cannot be missed (quite literally). You will see this architectural landmark towering in the city skyline when driving around the city and from many other places. But if you want to visit it, you’ll need to allocate a few hours.

Looking like a gigantic picture frame, this iconic structure consists of two vertical towers connected by a glass-bottomed bridge. From its observation deck, you can enjoy panoramic 360° views of the city’s evolving skyline on one side and the historical old town on the other.

The views are ok but – in our opinion – not as good as from the other observation platforms which we mentioned earlier in this itinerary. Still, we found a visit here quite worth it, because the building itself is truly remarkable.

Good to know: Depending on how busy it is, you’ll need 1-2 hours for a visit. Be sure to book tickets online or you may not be able to enter at all (we saw a few disappointed families turned away at the entrance). Even with timed tickets, the queues are still long, especially in the afternoon. So if you want to visit without wasting too much time, I recommend booking an early morning time slot.

AYA Universe

One of the more recent attractions in Dubai, we stumbled upon AYA Universe by coincidence. And so glad we decided to visit because it became one of our favorite experiences in the city!

It’s difficult to describe this unique attraction. It’s like stepping into a dreamy world with captivating light displays and mesmerizing high-tech experiences. If anything, I could compare it to the worlds you see in Avatar movies. A colorful, fairytale-like universe that guarantees lots of positive emotions. Recommended!

AYA Universe is located inside WAFI City Mall. The interior of this shopping center is inspired by an Egyptian theme and is quite interesting to see as well.

TIP: Book your tickets online if you want to be able to visit AYA Universe at a specific time slot. There were just a few people when we arrived here in the morning but it quickly got much busier. It’s a rather small facility and I think they cap the number of visitors that are allowed inside at the same time.

Good to know: Count about 45 minutes for a visit here, an hour if you also want to walk around the Mall (it’s very small compared to most others in Dubai).

iFly Dubai is an indoor skydiving center located in Mirdif City Centre Mall. This is your chance to experience skydiving in a safe and controlled environment. Btw, they have the real thing in Dubai too – see skydiving tours here .

Before you start, you get a short training session explaining some basic techniques. The regular experience includes two 1-minute flights. It may not sound like much, but they say that when you leap from a plane when actually skydiving, the free-fall time is even shorter than a minute.

Good to know: They work with time slots and allow about 10 people per half an hour, so it’s best to book in advance . iFly Dubai says that it’s suitable for all ages. Most people in our group were children and teens, but also a few adults. Count about an hour for the whole experience.

Despite the name, City Centre Mirdif Mall is not located in the center at all. It’s actually quite a drive from most other attractions in Dubai (about 15-20 minutes from Dubai Frame or AYA Universe). This shopping center is quite big and has many nice restaurants, so you can also have lunch here.

The Green Planet

+- 2 HOURS.

The Green Planet is an indoor rainforest featuring several thousand tropical plants and a variety of birds and animals freely roaming inside. If you’ve ever been to a rainforest in Costa Rica , the plants and the animals you can see here are similar.

The Green Planet has several sloths, squirrel monkeys, and all kinds of reptiles. You can also visit a bat cave, see all kinds of colorful birds, and admire the world’s largest man-made and life-sustaining tree.

It’s particularly nice for families with children but is very enjoyable for adults as well. Recommended.

TIP: For more info and to book tickets, see here .

Good to know: The Green Planet is located next to the City Walk Mall in the center, not far from the Dubai Mall area. Plan about 2 hours for a visit.

Also, the Green Planet closes at 6 PM (much earlier than most other attractions), so keep this in mind when deciding which places to visit on this day and in which order.

So, this sums up our recommended Dubai itinerary. As you can see, there’s A LOT to experience in Dubai and a week will fly by before you know it.

The nice thing about planning a trip to Dubai is that it has such a wide variety of activities and attractions allowing you to personalize your trip and find something that everyone in your group/family will enjoy.

I hope that our suggested itinerary gives you some inspiration on what to see and do in Dubai and helps you plan a perfect holiday.

More info & travel inspiration for Dubai:

• Dubai Travel Tips
• How Expensive is Dubai
• Dubai Public Transport
• Dubai in February
• Best Things to Do in Dubai
• Best Tours in Dubai
• Abu Dhabi Tour from Dubai
• Best Things to Do in Dubai with Kids
• Free & Cheap Things to Do in Dubai
• Interesting Facts About Dubai

If you found this post helpful, don’t forget to bookmark it and share it with your friends. Are you on Pinterest? Pin these images!

This site uses Akismet to reduce spam. Learn how your comment data is processed .

• Negros Occidental
• Ras Al Khaimah
• Events in the UAE
• Random Ramblings
• Travel BooBoos
• 20 Before 2020
• All About Lady

Jan 18, 2017

• Dubai Do-It-Yourself Tour 3 Days Itinerary

8 comments:

hi thanks for sharing this lovely and valuable post you have almost described everything about dubai in this post and the pictures you have shared its really apprecibale now im also lookin for some cheap dubai dubai holiday packages

such a beautiful ride! Me & my husband loves to do a small trip as we both work. Dubai is always our first chose. this time we are planning from Dubai visas uk Dubai visas uk for our amazing ride. Thank you for lovely post.

I love visiting Dubai especially for shopping there. This time I have already applied to my Dubai Visa and shop at Dubai Shopping Festival.

Excellent guide. I fallen in Love with Dubai after reading your stuff and hoping explore Dubai very soon. I recently found many useful information in your website especially this blog page covering every important visiting place at Dubai. Fantastic effort FootballacademyDubai Best from James

Just a helpful tip, it is better to find yourself low cost deals like what I did when I visited Dubai. I have managed to grab a deal on renting a private villa for AED 2500 on weekdays in Al Habtoor Polo Resort.

This blog has very distinct features. Thanks https://www.gudstory.com/best-annual-events-in-miami-fl/

Thanks for sharing such an interesting read. I will definitely be including this on my next trip to Dubai! Check our Dubai Itinerary 5 Days

دانلود نرم افزار گرفتن عکس و فیلم از دسکتاپ دانلود فیلم کمدی 2020 داستان کوتاه انگلیسی

• Blog Archives

Blog Archive

• ►  August (1)
• ►  July (1)
• ►  May (1)
• ►  April (1)
• ►  November (2)
• ►  October (4)
• ►  February (1)
• ►  January (1)
• ►  December (1)
• ►  September (2)
• ►  August (2)
• ►  July (2)
• ►  June (4)
• ►  March (3)
• ►  February (3)
• ►  January (4)
• ►  December (3)
• ►  October (2)
• ►  September (1)
• ►  May (3)
• ►  April (6)
• ►  March (6)
• ►  January (3)
• ►  December (2)
• ►  November (6)
• ►  October (1)
• ►  September (7)
• ►  August (3)
• ►  July (5)
• ►  May (4)
• ►  April (3)
• ►  March (7)
• ►  February (7)
• 5 Days in Thailand: Phuket-Bangkok Travel Itinerary
• Things to Remember Before You Visit Manjuyod Sandbar
• Centro Al Manhal: Hotel Stay and Adventure Package
• Barilla Restaurant in Dubai Festival City
• Mr. Crab Seafood Restaurant in Dubai
• Cool Instagrammable Cafes in Silay
• Lunch at Punong Gary's Place in Silay
• ►  October (7)
• ►  September (8)
• ►  August (10)
• ►  July (8)
• ►  June (7)
• ►  May (8)
• ►  April (8)
• ►  January (5)
• ►  November (5)
• ►  September (5)
• ►  August (6)
• ►  July (7)
• ►  May (5)
• ►  April (4)
• ►  March (13)
• ►  January (6)
• ►  December (7)
• ►  November (8)
• ►  October (9)
• ►  September (12)
• ►  August (9)
• ►  July (12)
• ►  June (9)
• ►  May (10)
• ►  April (7)
• ►  March (10)
• ►  February (10)
• ►  January (10)
• ►  December (10)
• ►  November (7)
• ►  October (12)
• ►  September (13)
• ►  August (17)
• ►  July (10)
• ►  June (12)
• ►  May (11)
• ►  April (10)
• ►  March (11)
• ►  February (11)
• ►  January (13)
• ►  December (12)
• ►  November (13)
• ►  October (16)
• ►  September (11)
• ►  August (11)

Let's Connect on FB

Lady and her Sweet Escapes

Watch me on Youtube

Follow me on instagram.

To revisit this article, visit My Profile, then View saved stories

This Art-Packed Dubai Home Delivers a Refreshingly Colourful Take on City Living

Exuberant and peaceful all at once, this colourful Dubai home in Al Barari stands apart from a sea of beige interiors.

Ask anyone who has lived in Dubai where to find respite from the chaos of the city and they will all point you in one direction: towards Al Barari. Surrounded by a manmade forest of mature evergreen trees, olive groves and all manner of local flora, this serene haven is a mere 20-minute drive from the bustling Downtown district (home to the world's tallest building, Burj Khalifa, and the world's biggest mall, Dubai Mall ), but feels a world apart. Here, instead of honking cars, residents wake up to birdsong.

A canvas by Reza Derakshani welcomes guests into Mana Jalalian’s home in Al Barari, Dubai.

The greatest design stories from AD Middle East, delivered to your inbox

“After spending the pandemic in a high-rise on Sheikh Zayed Road, I wanted to live at a gentler pace,” says the Iranian art collector and interior designer Mana Jalalian, who moved to Dubai in 2018 seeking a fresh start. “I was living in Vancouver before I came here, in a hamlet surrounded by greenery – it felt like a canvas that was changing every day.” In Al Barari, she got the same feeling of being immersed in nature, but not just any house would do; Jalalian was not just looking for a home for herself, but also for her art collection, which features over 400 works.

The loft-like space showcases work by leading Iranian artists, including Mohammad Ehsai (left) and Shirin Neshat (right).

“I had looked at many buildings,” Jalalian recalls, “and suddenly one night, scrolling online at 3.30am, I found this one.” It was destined to be: not only was the apartment in the exact building she had wanted to live in, but its bones fitted her moodboard to a tee: the space boasts a triple-height atrium with light flooding in from a floor-to-ceiling glass facade, black window frames, and wooden flooring that contrasts with its concrete shell. “My art collection is stored in Vancouver and Basel, but I wanted to live surrounded by it,” she explains. “Now I have a home where I’m able to change pieces around easily. One day I might have just one large piece on a wall, and the next time you visit, it will be filled with many small ones. I like to switch the art around every three months.”

The split-level architecture creates unique vantage points in the apartment.

Artworks by Nargess Hashemi, Mehrdad Mohebali and Pooya Aryanpour on the staircase.

An Ode to the Architectural Wonders of Iran

Jalalian’s love for art and interiors began at a young age, when her uncle, an architect, would let her flip through his design magazines. “I loved looking at how other people lived,” she recalls. “I grew up surrounded by art, so it was very interesting to see how others were incorporating art into their spaces, too.” Those magazines opened up her eyes to creativity from around the world, but understandably, Jalalian’s heart beats for contemporary art from her native Iran, which makes up a considerable chunk of her collection.

Step Inside a Brutalist-Inspired Home in Iran

A Moissonnier cabinet and an assemblage piece by Ala Ebtekar.

Two large black-and-white portraits by Shirin Neshat greet guests as they enter Jalalian's gallery-like Dubai home in Al Barari, with the entrance hall opening up to a central living space where vintage Baccarat chandeliers and an open staircase draw the eye up towards a mezzanine. Throughout the space, Jalalian has showcased a broad range of work – from a throne-like red sculpture by Parviz Tanavoli to Timo Nasseri’s mesmeric mirrored plaque and a calligraphic piece by Mohammad Ehsai. All are united via their owner's unabashed love of colour.

The marble-and-grey show kitchen. The seating is inspired by the rug, by Faye Toogood for CC-Tapis.

Persian Feasts, Gallerist Leila Heller’s New Book of Iranian Family Recipes Is a Celebration of Life

The lure of ample wall space and gallery-like proportions is complemented with practicality: the apartment features an open-plan show kitchen as well as a hidden working kitchen (which keeps the messy side of hosting hidden from sight) and an adjacent studio space, which is connected to the main apartment via a glass door. “This was perfect for my husband and I, as we have lots of guests coming to visit,” says Jalalian. “When it’s not serving as a home office or a TV room, it becomes our guest bedroom.”

Shantia Zakerameli’s vivid canvas in the principal bedroom.

Jalalian in the entrance hall.

In 2023, Jalalian embarked on a new chapter in her professional life: having collaborated with the French heritage cabinetmaker Moissonnier for more than a decade, she launched its first Middle Eastern outpost in Dubai. “We had only been open for a few months when I was diagnosed with breast cancer,” she recalls. A quick diagnosis was followed by chemotherapy, a double mastectomy and reconstruction. During this period, her colourful Dubai home became her healing space. “I drew great strength and even joy from being surrounded by my art,” she says. Throughout the treatment, Jalalian continued to grow Moissonnier , and to attend art fairs when she could. Now she’s focused on raising awareness of breast-cancer treatments in the region. “You know what they say about surrounding yourself with things you love? I think my husband, friends and home kept me going.”

More on Art From the Arab World

• 7 Arab Modern Artists You Should Know
• 8 Islamic Art Destinations Every Art Lover Should Visit
• Curator Sara Raza Is Exploring ‘Punk’ From an Arab Viewpoint
• Boghossian’s New High Jewellery Collection Takes Us to the World’s Most Dazzling Palaces

Explore the world with tourHQ

• Destinations
• I am a Guide
• I am a Traveller
• Online Experiences
• Currency (USD)

Spiked by the Burj Khalifa, surrounded by undulating deserts and glimmering with commerce and energy on the edge of the Persian Gulf, Dubai is simply not to be missed. tourHQ has plenty of tour guides in Dubai to experience the architecture of Dubai.

Search Cities in United arab emirates

Dubai Tour Guides

Vishal Saluja

Hello Everyone, Welcome to our Amazing, Magical and Wonderful city. City where people ...

Myself , Jose' Gomez! I was not born in Dubai but Dubai is my home .I have been living in this city ...

Shajahan Abdul azeez

The city of Dubai, a sparkling gem in the desert, is host to more than 10 million visitors a year. ...

Sachin Sharma

I am a tourism passionate and have more than 10 years experience in the field of travel and ...

Malgorzata Maria Rdzanowska

Living nearly 25 years in Dubai I have had already great knowledge about the city, its history, and ...

Anne-Sophie Lozano Kramer

 l do everything  with a passion for delivering the highest levels of quality and service ...

Muhammad Rafiq

Hello, bonjour, Hola, Namasty, SalamSo glad that you are intrusted to explore our city during your ...

Emad Mohamed

I was born under the sun and the history of ancient Egypt; I studied Egyptology at Sohag ...

MAHMOUD ZIDAN

Certified Tour Guide in the UAE . English, French, Arabic, Hebrew & Russian speaker.U.A.E ...

Muhammad Anwar Shah

I am an English-speaking guide in Dubai offering custom, authentic and private tours of Dubai and ...

Navas Saidu Mohammed

Hello my fellow travelers, welcome to my tourHQ page!I am an Authorised Tour Guide in Dubai since ...

Ute Koestle

I am from Germany, but I have been living in Dubai for last 23 years and also working in ...

Travel with me, let me guide you! Welcome to my profile. My name is Erika. I am native ...

Rijad Ahmad

I am a passionate Tourist Guide living in Dubai for around 6 years and qualified to guide ...

Muhammad Saghir

Hey!! This is Muhammad,اسلام علیکم ! مرحبا ، کیف ...

Abubakker Sideq

Hello everyone,I'm Abubakker Sideq, a proud resident of Dubai for the past 16 years. This vibrant ...

Everything in Dubai promises to be the biggest and the best. The city-state is a one of a kind wonderland where gravity-challenging structures reach to the skies and ambitious mega projects displace seas to shine in the Dubai sun. Dubai’s ostentatiousness is the magnet that draws tourists in throngs from near and far. Lavish malls that are impossible to traverse in a day call out to shoppers to cash in on scandalously fantastic retail deals at the much-awaited Annual Dubai Shopping Festival. Bargain hunters for gold come away satisfied with the price and quality they desire at the Gold Souk. For the adrenalin rush, a Dune bashing tour, riding out steep dunes with a 4-wheel drive is just the thing to do. Remember to ask your Dubai Tour Guide for the complete package, with the graceful moves of a belly dancer providing entertainment at a Middle Eastern feast laid out in the desert. Dubai is undoubtedly the most liberal of the Emirates; waterparks, unparalleled hotels, pubs and restaurants offering an enviable assortment of international cuisines along the walk at JBR are testimony to the successful venture of making a Dubai a truly world class city.

Tell us your destination, date, and group size.

Our team of travel experts and guides will design a tailored itinerary just for you., enjoy your trip with peace of mind knowing everything is taken care of..

Say Goodbye to Travel Stress

Choose Currency Close modal

• USD US, dollar
• GBP British Pounds

Cookie icon We use cookies!

We, and third parties, use cookies for technical and analytical purposes, for marketing purposes and for integration with social media. For more information, refer to our Privacy Policy and Terms of Consent.

By clicking on 'I agree', you consent to the use of these cookies.

Experience the best of Dubai with Withlocals

Find the perfect private tour

Select one of our local experts

Enjoy Dubai like a local

Let our local experts guide you through a handpicked selection of things to do on a private tour. Think hidden gems, insider stories, and all the local vibes. Ready to find your private tour of Dubai? Your adventure-packed day is just one click away!

Top 10 tours in Dubai

Make your stay in Dubai complete with these things to do

1 The 10 Tastings of Dubai: Street Food

2 Highlights & Hidden Gems of Dubai

3 A Magical Evening in Dubai: City Tour

4 Withlocals Your Way! - Dubai City Tour

5 City Discovery: Abu Dhabi Day Trip

6 Dubai in a Day - Ancient & Modern city experience

7 The Ultimate architectural gems & Burj Khalifa Day Trip

8 Dubai Private Layover Tour & Transfers

9 Dubai Late Night Layover Tour

10 The Flavors of Dubai: Street Food Tour

Why you should book a withlocals tour, 100% customizable.

Let your local host tailor the tour completely to your wishes.

Private guided tours

No strangers on your tour. It’s just you and your local host.

Responsible

Our tours are designed with people, places & the planet in mind

Private tours with locals in Dubai

Our locals will give you the best experiences that Dubai has to offer

The 10 Tastings of Dubai: Street Food

Highlights & hidden gems of dubai, a magical evening in dubai: city tour, withlocals your way - dubai city tour, city discovery: abu dhabi day trip, dubai in a day - ancient & modern city experience, the ultimate architectural gems & burj khalifa day trip, dubai private layover tour & transfers, explore dubai with our incredible locals.

Learn about their personal stories and find out how you can explore Dubai with locals

Dubai Late Night Layover Tour

The flavors of dubai: street food tour, old dubai history tour:, complete dubai tour: highlights & desert adventure, architectural wonders of dubai with gomez (day / night), best of dubai city tour & at.mosphere lounge (burj khalifa), dubai sightseeing full day tour, dubai layover private tour by public transport, find experiences by category.

Discover experiences based on your interest

• City highlights tours 9
• Day trips 4
• Food tours 3
• Art & Culture tours 1
• Night tours 1
• Off the beaten track tours 1
• Skip the line tours 1

Travelers love our locals

What other guests say about our tours and locals

A great way to see Dubai! Recommend!

"I couldn’t be more pleased with this tour. We covered so many highlights of Dubai and I learned so much about the history and culture. The route was well planned out, with little wasted time in traffic. The driving was safe and comfortable. I received tips on places to return to if I wanted to explore more in depth. A very enjoyable experience "

Amazing and informative

"We took two full day tours with Sandy, Dubai Old and New and Abu Dhabi. They were both amazing! Sandy is so knowledgeable, and personable. We could not have asked for more. We highly recommend Sandy to anyone who would like to explore and discover the beauty of these two beautiful cities. "

An AMAZING experience!

"We had a few hours spare late at night in Dubai. We decided to do Sandy and Jose’s Late night layover tour and what an experience it was! Sandy was filled with so much knowledge about current and past history of the UAE, it left us in awe. I learnt so much, and am so amazed by this country and the futuristic thinking it upholds. I would highly recommend to anyone ☺️"

A Great Day in Abu Dhabi

"We did the Abu Dhabi day trip with Sandy Nat and driver Ranju. We were picked up promptly at the arranged time and set off from Dubai to explore Abu Dhabi. We had requested specific stops for our tour which were accommodated by Sandy. So you can make this tour bespoke. Sandy is extremely knowledgeable and able to answer all our questions. We started off at the Grand Mosque (and so helpful that Sandy had made all the arrangements so we were able to fast track entry) which was stunning and so beautiful. Sandy shared so much information on the building of the mosque and each area’s significance which made this visit truly memorable. Our next stop was the Emirates Hotel (former palace) and along the drives we were also able to see specific sights that Sandy pointed out (which we were not aware of) - such as the seven buildings that are designed to look like the five fingers of a hand. Next stop was Heritage Village for a self guided tour of the humble beginnings of the first ruler of the UAE. Enroute to lunch we passed a few more sights and also saw the new palace from across the ocean (overlooking a bay). We stopped for lunch at Al Mrzab for truly Emirati cuisine (which is also recommended by the Michelin Guide). The afternoon consisted of a stop at the date market and the Louvre museum. We toured the museum which happened to also house several works of art by renowned artists Money, Manet, and Renoir (without the lines like the French Louvre). The final stops included driving through Ferrari World and the parks on Yas Island. We did not wish to stop here but they can be added to one’s itinerary. The day was packed with activities we chose and we continued to learn about the Emirati culture from Sandy during the drive back to Dubai. Sandy - Thank you for a most wonderful experience and for sharing some of the sights your home has to offer."

Highly recommend!!!

"This was a fabulous tour for my family (my husband and I and 3 adult sons)! We were very stressed arriving to the tour because our Taxi driver took the wrong way, got stuck in traffic and tried dropping us off where we weren’t supposed to be. I communicated this to Sandy and he was very happy, understanding and energetic despite us being 15 min late. We tried so many foods and snacks. Loved Sandy’s enthusiasm for food and culture and the 3 he tour flew by! Thanks for a wonderful time!!"

A good overview of Dubai

"We had a great day with Sandy and Jose. A perfect introduction to Dubai for first time visitors. We learned a lot about the development of Dubai over the past few years and saw many of the top attractions from the comfort of the air conditioned car- important since it was around 105 degrees outside! We also took a boat into Old Dubai and went to the souks-the Spice market and the gold market. Both were interesting experiences! We had decided beforehand with Sandy to get skip the line tickets up to the 144th floor of the Burj Khalifa which offered us an amazing view with quick access. We were dropped off and Sandy picked up the tickets for us. After the tour we were met again at the same location and driven back to the hotel. Very convenient. It was truly a great day and Sandy and Jose made everything very easy for us and did all we had hoped for. I would definitely recommend them to other travelers. "

Fabulous Local Dubai Experience

"We booked this night tour of Dubai after reading the reviews and were not disappointed. Sandy was a gracious host and tour guide. He was very communicative to our arrive and took any anxiety we might have had by giving us clear and specifics on meeting location and what to expect upon arrival. After following the sign with our name he took us on a very informative, entertaining and educational 4 hour tour of Dubai including ALL of the highlights but also a tour of Old Dubai so we could experience the changing cultures. His descriptions were clear and understandable in English. We would highly recommend him."

"I had an afternoon/evening layover in Dubai and wanted to get out to see the city. Communication with Sandy and Jose beforehand was very easy, and I felt very comfortable making the arrangements to meet up. Sandy picked me up at the airport and gave me a tour of Old Dubai, New Dubai, and per my request customized it to finish with the fountain show before taking me back to the airport with plenty of time before my flight. It was extremely hot in Dubai at that time, and I definitely wouldn't have been able to go out and visit on my own with the heat and humidity. Having the opportunity to tour in a comfortable, air-conditioned van was amazing. I had the opportunity to take lots of pictures and walk around local sights (while also being able to go back to the van to cool down and move on to the next stop). I'm really glad I found out about this opportunity because I believe this tour really gave me a chance to get to know Dubai despite only being in Dubai for a layover! My favorite part was the food tasting -- it was so delicious, I got seconds!! "

Sandy and Jose are amazing

"This was such a great 4 hour night tour of Dubai. Sandy is a great guide and great person, he went out of his way to show us everything and more. Thank you!"

Simply BEST Tour Ever! Thank You Sandy :)

"Everything from start to finish was wonderful. Sandy met us at the Airport with a fantastic smile right on time. We were taken to a brand-new Toyota which was luxurious, met the driver who was wonderful the whole tour. We not only saw the old and new of Dubai, but we also had a boat trip across to the canal. Before the boat ride he introduced us to a "not so spicy" kebab, which was delicious. The number of photos we got was incredible as the driver kept stopping at all the top spots. We encourage to book Sandy & Jose for a tour especially a "Night Tour", best way to see Dubai. We had a 11-and-a-half-hour layover, it certainly made the time go by having this tour. Thank You both again."

Enjoy the Best of the Dubai Like a Local

Private & personalized tours in dubai with a local.

When you hit the road and land in a new city like Dubai, there's an exciting way to dive into its soul: personalized local tours. Forget the typical touristy routes – these tours are like having a local friend show you around all the cool spots.

Imagine having someone who lives and breathes Dubai spill its secrets. That's what local guides bring to the table. They know the hidden alleys, the best bites, and stories that never made it to the guidebooks. Whether you're into munching through food tours, wandering the city's streets, or going off the beaten path, a local guide hooks you up with a private tour that's authentically Dubai.

The best part? These tours are all about you. No herding in big groups or rushing through places you're not interested in. With private tours, you're the boss. Whether it's snapping pics at iconic landmarks, diving into history, or checking out the art scene, the tour is tuned to your vibes at your tempo.

But it doesn't stop at city limits. Day trips let you escape the urban jungle and explore nearby wonders. And if you're just setting foot in Dubai, kickstart tours give you a taste of everything. Think of it as a crash course in Dubai awesomeness, guided by a local who knows the city like the back of their hand.

So, next time you're in Dubai, ditch the ordinary. Grab a local tour and unlock the city's real magic – the stories, flavors, and places that make it uniquely Dubai. Get ready to explore like a local!

Related Dubai pages

You might be interested in these

• Guides in Dubai
• City Highlight Tours in Dubai
• Day Trips in Dubai
• Food Tours in Dubai
• Art & Culture Tours in Dubai
• Night Tours in Dubai
• Off The Beaten Track Tours in Dubai
• Skip The Line Tours in Dubai
• Sports & Leisure in Dubai
• Wildlife & Nature Experience in Dubai
• Walking Tours in Dubai
• Car Tours in Dubai
• Boat Tours in Dubai
• Short Tours in Dubai
• Half day Tours in Dubai
• Full day Tours in Dubai
• Luxury Tours in Dubai
• Things To Do Tomorrow in Dubai
• United Arab Emirates
• Tours in Dubai

This is now in your Top Picks!

Login or create an account to save your favourites and receive personalised recommendations.

Login to like

Sign in or register to like this content

Welcome to a sun-soaked metropolis like no other

Plan your dream wedding in an unforgettable destination

Discover the city's insiders, influencers and innovators

Every district in Dubai tells its own unique story

Admire the city's traditional arts, crafts and cultural gems

Get more out of your holiday with these guides

Escape to the hills and explore nature

Answer the call of the wild and experience desert thrills

Uncover the city’s rich heritage and vibrant arts scene

Embark on thrilling new adventures for all ages

Taste award-winning world flavours and local cuisine

Visit the latest hotspots, openings and attractions

Find new surprises at modern malls and traditional souks

Marvel at record-breaking venues and iconic landmarks

Unwind at Dubai's luxury spas and wellbeing havens

What do you travel for? Find inspiration with our itineraries

Book a table at these fresh hotspots

Taste a deliciously different side of Dubai

Discover our homegrown culinary heroes

See all the restaurants unveiled in the Dubai selection

Weekends in Dubai are for feasting

Explore Dubai's plant-based concepts that impress

Reserve a table at top restaurants for incredible prices

Discover Dubai's top dining experiences with our restaurant guide

Don't miss a beat – live concerts, festivals, activities and more

Get active with 30 minutes of exercise for 30 days

Grab incredible deals on furniture and appliances

Shop, win and celebrate with incredible deals and prizes

Celebrate Diwali with extravagant experiences, sales and fireworks

Plan ahead for a hassle-free travel experience

From etiquette to currency, we answer all your questions

Use our tool to book flight tickets to Dubai and plan your trip to the city

Dubai has an incredible range of stay options for every budget

From take-off to touchdown, navigating Dubai is a breeze

Your complete guide to enjoying one of the world's safest cities to the fullest

Find out all about Dubai’s climate throughout the year with our weather guide

All you need to know about the dirham, from exchange rates to helpful tips

Helpful information for travellers with special needs

Unlock huge savings with pre-paid access to top spots

Get our apps for the latest attractions, events & itineraries

Save big with great offers on Dubai's top sights and activities

Indulge in retail therapy for less with big discounts

Enjoy a trip to Dubai with incredible accommodation offers

Sing along with the Leto brothers

Sign up for kid-friendly activities or attend a live show with the entire family

Ring in 2025 with the musical icon

Get tickets to the best concerts featuring A-list artists at world-class venues

Join Dubai's community sporting activities and race to the finish line

Attend this sporting and entertainment extravaganza

Get ready to rock with the legendary band

Gear up for this highly-anticipated street culture festival

Related Sites

Add items to your Top Picks by clicking the heart icon as you navigate through the website

• Visit Dubai
• Top attractions

Things to do

31 amazing things to do in Dubai for the ultimate holiday

Sun, August 14, 2022

Tick off the city's top things to do and places to visit.

Burj Khalifa

Standing 828m high, the  Burj Khalifa  is the tallest building in the world and one of Dubai's must-visit attractions. The majestic building is located in the heart of the city and is a hub of activity day and night. Just looking up in awe at the sheer scale of this magnificent structure is memorable in itself, but it's definitely worth venturing inside too. You can capture perfect views of the city from the  observation  deck at levels 124 and 125, or have a bite to eat in the  At The Top Sky Lounge . For special occasions, treat yourself to a sunset session at The Lounge, Burj Khalifa ,  the highest lounge in the world at 585m. 

Opening hours - At The Top:  8am - 12am, daily

Price - At The Top: from AED169

• 1 Sheikh Mohammed bin Rashid Blvd, Downtown Dubai

The Dubai Fountain

Located at the base of Burj Khalifa  is one of the world's largest choreographed fountain displays, where powerful jet streams soar as high as 150m in the air and sway in time to musical numbers. Stop by in the evening when displays begin at sundown and take place every 30 minutes, until the final song plays at 11pm. Diners can also sit back and enjoy the show at an array of restaurants at Dubai Mall  or Souk Al Bahar , both commanding prime positions near the fountain arena.

Opening hours:  6pm - 11pm, daily

Price:  free

• Dubai Mall, Downtown Dubai, Dubai

Palm Jumeirah

Palm Jumeirah is one of the largest manmade islands in the world and a triumph of human ingenuity. Locals and tourists alike flock to its vast array of high-end hotels – Waldorf Astoria, Fairmont, One&Only, Jumeirah Zabeel Saray  and, perhaps most notably, Atlantis, The Palm . Getting here is simple, thanks to the monorail running down the 'trunk', which connects to the mainland's tram system.

• Palm Jumeirah - Dubai - United Arab Emirates

Dubai Creek

• Baniyas Rd, Deira, Dubai

Al Fahidi Historical Neighbourhood

Al Fahidi Historical Neighbourhood in Bur Dubai is one of the oldest neighbourhoods in the city. Best seen on foot, this area offers nostalgic views of a bygone era with traditional windtowers and a maze of winding alleyways, positioned along the historic waterways of Dubai Creek. Visit Sheikh Mohammed bin Rashid Al Maktoum Centre for Cultural Understanding (SMCCU) to appreciate local culture with Arabic classes, heritage tours and guided mosque visits. After exploring, take an atmospheric abra  boat ride  to the souks on the other side of the creek. 

• Al Fahidi St, Al Souq Al Kabeer, Bur Dubai

The Dubai desert

Less than a 20 minute-drive from the modern streets of Downtown Dubai lies the mystique-filled Arabian desert. Go on a Dubai-style desert safari, complete with thrilling activities  such as quad biking and sandboarding. Those looking for luxury can book a safari with leading tour companies  Platinum Heritage  and Arabian Adventures . From the unforgettable offroad drive to cultural fun with henna painting and camel rides, and a feast of local cuisine under the stars, it's an only-in-Dubai treat. Want to stay a little longer? Treat yourself to an unforgettable night amid the dunes at Al Maha Desert Resort & Spa .

• Dubai Desert Conservation Reserve, Dubai-Al Ain Rd - Dubai

Dubai Mall is the world’s largest destination for shopping, entertainment and leisure, located next to the world's tallest building, the Burj Khalifa. Featuring over 1,200 retail stores, two major department stores and hundreds of food and beverage outlets, Dubai Mall covers more than 1 million sqm – an area equivalent to 200 football pitches. Even an entire day spent here is not enough to see it all. Along with its 1,200-plus shops and 150 restaurants, the venue  is home to a range of other fun attractions.

Opening hours: 10am - 1am, daily, except Wednesday (closes at midnight)

• Financial Centre Road - Downtown Dubai

Skydive Dubai

If there's one thing every adventure-seeker must sign up for, it's a skydiving experience. Skydive Dubai provides tandem skydive opportunities, supervised by trained professionals. You'll have to book well in advance to secure a spot, but it's worth it as you dive through the clouds from 13,000 feet and take in views  of the landmark Palm Jumeirah or rolling dunes of the desert. And you can keep reliving the epic experience thanks to perfectly-captured videos by the Skydive Dubai team. It's one for every braveheart's bucket list.

• Al Seyahi Street, Dubai Marina - Dubai

Madinat Jumeirah

Literally translated as 'City of Jumeirah', the Madinat Jumeirah complex is inspired by an ancient citadel. Housing luxury hotels and private enclaves designed to reflect traditional Arabian architecture, it's a great spot to indulge in a therapeutic day at the world-class Talise Spa , splurge on local trinkets and boutique brands at the Madinat Souk , or immerse yourself in the work of famous artists at the high-tech Theatre of Digital Art . And, with over 40 restaurants and lounges featuring cuisines from around the world, it's also an ideal place to refuel.

Opening hours & price: vary, depending on venues within the complex

• 6 King Salman Bin Abdulaziz Al Saud Street, Dubai

Dubai Frame

Since opening in 2018,  Dubai Frame  has become a cultural landmark that connects the Dubai's past with its present and represents a remarkable engineering feat.  Located within Dubai's famous Zabeel Park , this attraction lets you experience the transition between Old and New Dubai thanks to sweeping panoramic views of the city from 150m high. One of its striking features is the state-of-the-art clear glass bridge walkway, which connects parallel vertical towers so that, from the outside, the structure perfectly resembles a giant picture frame.

Opening hours:  9am - 9pm, daily

Price:  from AED20

• Zabeel Park, Za'abeel 1 - Dubai

The aptly-named Kite Beach is the perfect place to test out your watersports skills , although there's plenty to do out of the water at this popular spot too. Grab a smoothie from one of the many open-air cafes and restaurants, watch bikers and skaters fly by at the skate park, or enjoy a game of volleyball with friends on the sand. With plenty of beach activities, plus an incredible view of Burj Al Arab  in the distance, you can easily spend a whole day here.

Opening hours: 24 hours, daily, although sporting and dining venues at the beach have varying timings.

• Umm Suqeim, just off Jumeirah Beach Road, Dubai

Dubai Water Canal

Dubai Water Canal is a 3.2-kilometre-long waterway extending from the Creek in Old Dubai  through Business Bay before finding its way to the Arabian Gulf. With 80,000sqm of public space and facilities and a 12km cycling path, the Canal has become a popular visitor attraction. There are also five pedestrian bridges that snake their way across the iconic waterway, so it's the perfect spot to stroll and take in classic views of the city at its best. Nearby is the Al Habtoor City  development, home to the thrilling  La Perle by Dragone  show, five-star hotels and an array of trendy restaurants.

• Dubai Water Canal, Al Safa, Dubai

If you'd like to shop, dine, watch a movie and swim in the sea all in one place, consider a trip to The Beach, opposite Jumeirah Beach Residence (JBR). With guest DJs playing on most weekends, a cinema and plenty of trendy boutiques , The Beach is always buzzing with activity. Take your pick from the range of dining options, try the exhilarating watersports on offer or just enjoy some relaxation time in a cabana with your favourite book. The Beach is also connected to the trendy new  Bluewaters Island  district by a pedestrian bridge.

Opening hours - F&B outlets: 10am - midnight, Saturday - Wednesday, extended to 1am on Thursday and Friday 

• The Beach, Jumeirah Beach Residence, Dubai

City Walk offers European-style pedestrian streets alongside a host of shopping and entertainment options – perfect for a pleasant day out. Take a walk along tree-lined avenues with shops and restaurants and spot artwork etched by some of the world's finest urban artists . Afterwards, treat your family to an afternoon of fun and head over to The Green Planet  to see real wildlife in an indoor tropical rainforest setting. You can also catch a concert, live sports or a comedy show at the nearby  Coca-Cola Arena , the Middle East's largest indoor arena.

• Al Wasl and Al Safa Road Junction, Sheikh Zayed Rd - Al Wasl - Dubai

Dubai Miracle Garden

A world of floral wonder awaits you at Dubai Miracle Garden, the world's largest natural flower garden. The 72,000sqm park has an impressive line-up of famous buildings and structures completely transformed into colourful flower displays. You can immerse yourself among more than 50 million blooming flowers throughout the different exhibits. The nearby Dubai Butterfly Garden  is also worth a trip. Here, children can explore over 15,000 species of butterflies whilst learning more about them in a fun setting.

Opening hours:  9am - 9pm on weekdays, extended until 10pm on Saturday and Sunday

Price:  from AED60

• Al Barsha South 3, Dubailand Area, Dubai

Dubai Opera

Located in the Downtown district, Dubai Opera offers an enticing performing arts schedule from the likes of London’s West End and Manhattan’s Broadway. With views of  The Dubai Fountain  and located next to Burj Khalifa , the eye-catching exteriors are inspired by Arabian dhow ships while the stage area is designed to easily convert into three different event platforms: theatre, hall or concert hall. Want to know what's playing at Dubai Opera while you're holidaying in the city? Visit  Dubai Calendar .

Opening hours:  10am - 9pm, daily (show timings may vary)

Price:  from AED145

• Sheikh Mohammed Bin Rashid Boulevard (near Burj Khalifa), Downtown Dubai, Dubai
• Dubai Marina

A 130km drive south-east of Downtown Dubai is Hatta , a not-to-be-missed scenic getaway. In this mountain town you can try kayaking along the serene Hatta Lake, or traversing rocky mountains on foot with specially-crafted hiking experiences . Recent additions to the area include Hatta Dome Park ,  a glamping experience that takes advantage of  Hatta’s mountainscape  views and back-to-nature vibes, plus  a chic lodge-style hotel and trailer parks. Indulge in a host of adventure activities such as zorbing, mountain biking and more at Hatta Wadi Hub. Don’t forget to pack your swimsuit, as the Hub is also home to Asia’s first ever water jump park, Hatta Drop-In.

• Hatta Wadi Hub, located off the Dubai-Hatta road, Dubai

IMG Worlds of Adventure

Unlimited fun, excitement, speed and 5D entertainment – you can expect it all at IMG Worlds of Adventure. This enormous theme park  is the same size as 28 football pitches put together. With the most up-to-date and exciting rides , IMG Worlds of Adventure brings your favourite characters to life. Give your little ones the best time with rides featuring Ben 10, Powerpuff Girls and LazyTown, while older kids can delve into the world of Spider-Man, Hulk, Iron Man and The Avengers.

Opening hours : noon - 10pm, Sunday to Thursday, extended to 11pm on the weekend

Price - general admission:  AED345

• E311, Sheikh Mohammed Bin Zayed Road, City of Arabia Dubai Land, Dubai

Dubai Parks and Resorts

Dubai Parks and Resorts adds to the city's reputation as an entertainment paradise. Children are bound to get excited in the labyrinth of magnificent theme parks, which includes  Motiongate , Real Madrid World  and Legoland and Legoland Water Park . Adults can relax at the Riverland Boulevard , home to restaurants and a range of open-air entertainment. Don't want to leave? Check in to the luxury Polynesian-style hotel, The Lapita, or the region's first and only Legoland Hotel, both located within the theme park destination.

Opening hours:  10am - 11pm, daily

Price - One Park Pass:  from AED295

• Sheikh Zayed Road, Opposite Palm Jebel Ali, Dubai

The View at The Palm

Enjoy incomparable views of one of Dubai’s most talked about landmarks at The View at The Palm. Located 240m high, the observation deck presents never seen before 360-degree panoramas of  Palm Jumeirah  alongside the sparkling waters of the Arabian Gulf and Dubai skyline  in the distance. The View at The Palm is located on level 52 of The Palm Tower, which also houses a café, a creative exhibition that showcases the development of the island, interactive aquarium-themed tunnels and a gift shop. 

Opening hours : 9am - 10pm, weekdays, extended to midnight on weekends

Price:  from AED100

• Level 52, The Palm Tower, Palm Jumeirah, Dubai

Deep Dive Dubai

The latest addition to the city's thriving sports and adventure activities scene, Deep Dive Dubai is the place to be for all aqua enthusiasts . The recreational centre's 60.02m-deep pool is certified by Guinness World Records as the world's deepest swimming pool for diving. Aside from its remarkable depth, the pool features other unrivalled underwater additions, such as a 'sunken city', alongside year-round freediving and  scuba diving  courses and guided experiences.

Opening hours : 9am - 6pm, except on Friday (closed)

Price:  from AED400

• Deep Dive Dubai, NAS Sports Complex, Dubai

Sky Views Dubai

Thrill-seekers can try a trio of epic experiences at Sky Views Dubai, perched 219.5m above ground on top of the Address Sky View hotel. The Glass Slide allows visitors to zoom down a transparent tunnel on the 53rd floor, while the Observatory features a glass elevator and bridge to further test your head for heights. Meanwhile, true risk-takers will look forward to the Edge Walk – as they dangle off the building's side while strapped to a safety harness. All three experiences allow participants to enjoy phenomenal views  of Downtown Dubai's iconic landmarks, including the nearby Burj Khalifa .

Opening hours : 10am - 10pm, weekdays, extended to midnight on weekends

Price:  from AED70

• Address Sky View hotel, Emaar Square Area, Downtown Dubai

Burj Al Arab

For the first time since its launch, Dubai's famed Burj Al Arab  has opened its doors to visitors, granting access to the hotel's ultra-luxurious interiors on an immersive 90-minute tour. Not only will you get to explore the landmark’s gilded suites, and enjoy its incomparable views of the city , but you'll also uncover the hotel’s history and wealth of untold stories. You can also delve deeper and make the most of your experience with tour customisations.

Tour timings: 9:30am - 8:30pm, daily Price: from AED249

• Jumeirah Road - Umm Suqeim 3 - Dubai - United Arab Emirates

Museum of the Future

One of Dubai's most famous architectural landmarks , the Museum of the Future  takes pride of place along the city's superhighway, Sheikh Zayed Road. Founded by the Dubai Future Foundation, the museum explores how society could evolve in the coming decades using science and technology. Termed a 'living museum', it incorporates elements of traditional exhibitions, immersive theatre and themed attractions, so visitors can look beyond the present and towards the future's limitless possibilities.

Opening hours : 10am - 9:30pm, daily

Price:  from AED149

• Sheikh Zayed Road, Trade Centre - Dubai

Mohammed Bin Rashid Library

Built along the historic Dubai Creek and designed in the shape of a traditional Islamic lectern, the Mohammed Bin Rashid Library is the latest cultural hotspot to open its doors in the city. A landmark  unique to Dubai, the library is the largest in the region and representative of its collective cultural wisdom, educational milestones and continued forays in research and academia. Aside from enjoying the remarkable architecture and exploring the library's nine levels, visitors can discover a fully digitalised laboratory and several specialised collections inside.

Opening hours : 9am - 9pm, daily, except on Friday (opens 2pm) and Sunday (closed)

Price:  free

• Dubai Creek, Al Jaddaf

Serious foodies can’t possibly visit Dubai without making a stop at the  MENA 50 Best Restaurants  top spot, 3Fils. Its chic yet casual setting, coupled with calming harbourside views and a no-reservations policy, makes this one of Dubai's most unassumingly spectacular dining hotspots . Serving modern Asian cuisine, you’ll find tantalising dishes such as salmon carpaccio, wagyu sushi and fire-grilled octopus on the menu.  Opening hours : noon - 11:30pm, daily

• Shop 2, Jumeirah Fishing Harbour 1, Al Urouba St, Jumeirah - Dubai

Aura Skypool

Unwind in the world's highest 360-degree swimming pool as you gaze out at landmarks including Burj Al Arab  and Ain Dubai. Situated 200m above ground, AURA Skypool is the perfect place for an unforgettable swim. Visitors to the Palm Jumeirah venue can also relax in its chic lounge area and sample a menu filled with delicious sharing plates and Pan-Asian flavours . Standouts to try include the glazed miso salmon, chilli honey cauliflower popcorn and matcha tiramisu. 

Opening hours : 10am - 7pm, daily

Price:  from AED150

• The Palm Tower, 50th Floor, Palm Jumeirah

Prepare to be amazed by Dubai's first permanent show, which combines acting, acrobatics, aquatic feats and aerial stunts across an exhilarating 90 minutes. All the action takes place inside a tailor-made, 1,300-seat theatre in the heart of Al Habtoor City , featuring a high-tech ‘aqua-stage’ that can fill with 2.7 million litres of water. Watch from the edge of your seat as performers dive, fly and defy gravity, as they tell a story which pays homage to the UAE's pearl diving history .

Show timings : 6:30pm - 8pm & 9pm - 11:30pm, daily

Price:  from AED209

• Al Habtoor City, 260 Sheikh Zayed Rd, Business Bay - Dubai

Alserkal Avenue

Once an industrial area in the centre of Dubai, Alserkal Avenue now comprises around 40 warehouses, converted into galleries, dance studios, artisanal cafes and more. The neighbourhood has nurtured a culture of creativity and is now one of the region’s leading art hubs. Since its humble beginnings as a standalone gallery in 2008, word caught on and similar concepts soon moved into the area. Popular spots include arthouse theatre  Cinema Akil , the hipster-inspired  Nightjar Coffee  and Leila Heller Gallery.

• 17th Street, Al Quoz 1, Dubai

Expo City Dubai

Building on the legacy of Expo 2020 Dubai , which welcomed 192 nations and more than 24 million visitors, is the future-centric Expo City Dubai. Explore popular country pavilions including the falcon-inspired UAE Pavilion, award-winning Kingdom of Saudi Arabia Pavilion and reworked spaces for Luxembourg, Pakistan and Australia. Alif – the Mobility Pavilion and Terra – the Sustainability Pavilion have been transformed into interactive educational experiences, while the Opportunity Pavilion is now the Expo 2020 Dubai Museum.  Al Wasl Plaza , the Dubai Exhibition Centre, the Garden in the Sky observation tower and the Surreal water feature also remain at Expo City Dubai, which has its own metro station. 

Opening hours: 24 hours daily, though attraction timings vary Price: free to enter, though attraction tickets vary

• Expo Road Dubai South, Jebel Ali

Frequently asked questions

What can you do for free in Dubai?

What can't you miss in Dubai?

What can I do in Dubai at night?

Where can I go to the beach for free in Dubai?

Do you like it? Share it

Recommended reads.

Discover Dubai differently

Stories, events, offers & more!

• Middle East

© 2024 - All rights reserved. Designed and developed by Fork Media Group

Savour Mumbai’s Street Food And Southeast Asian Delicacies At The Newly-Opened 59 Street Gastropub In Al Barsha, Dubai

From kheema paav, anda burji to chicken lollipops, satiate your craving for mumbai’s notorious street food with the 59 street gastropub in al barsha dubai.

“Come to Bombay, Come to Bombay, Bombay Merry hai!” But how will you come to Bombay and savour its delicious street food whilst being stuck in the daily grind of Dubai? Well, the newly-opened 59 Street gastropub in Al Barsha brings Mumbai’s authentic street food to your table without a ticket to Mumbai! The Indo-Asian gastropub open in the heart of Dubai offers authentic Mumbai street food along with Southeast Asian delicacies. The Southeast Asian-themed lively bar culture features snarky one-liners and famous quotes on Mumbai making it the perfect hangout spot for every Mumbaiker in Dubai.

Hog On Mumbai’s Street Food And Savour Southeast Asian Delicacies At 59 Street

If Bombay is indeed your jaan, you cannot miss visiting this gastropub. The cool new spot promises a buzzing vibe and great tunes with a menu that will make your mouth water! The spicy and punchy flavours of Mumbai street food perfectly complement the Southeast Asian-themed bar culture and vibe. Do not miss out on the Kheema Paav, Aloo Corn Tikki, and Anda Bhurji that transports you to the streets of Mumbai. Want to go a bit healthier? Try their Tandoori Chicken Lollipops, Tawa Fry, Seekh Kebabs and Butter Chicken. We guarantee that these dishes will evoke the nostalgia of Mumbai with every bite.

Their delicious menu is far from over though! If you are in the mood for some Southeast Asian cuisine, try some Asian favourites like Singaporean Chilli Crab, Moreover, the Nasi Goreng, Dimsums, and Wasabi Prawns are also a hit here. Additionally, you can also indulge in the chef’s family’s own recipes like the Mama’s Chicken Roast adding a heartwarming touch. The delicious menu comprising dishes that are spicy, savoury and punchy comfort food, makes for a much-needed visit! How can we forget the lip-smacking beverages like the Mango & Mint Mojito or a Chai-Spiced Spirits Sour served with happy hours running all day, every day!?

Also Read:  7 Best Diwali Buffets In Dubai That Celebrate The Festive Spirit With Culinary Delights

What Else Can You Expect At The Restaurant In Dubai?

The ambience of this gastropub is a testament to Southeast Asia’s lively bar culture. The buzzing vibes, great tunes and funny Mumbai-centric punch liners make it the perfect hangout spot for all the Desis. Moreover, the dim lights highlight the beauty of the subtle art paintings infused on the pub’s walls. Featuring neon lights, exposed brick walls, and lively DJ nights on weekends, 59 Street captures a fun and relaxed atmosphere. The brainchild of food blogger Bosco Pereira and his chef brother Dominic, 59 Street offers a mix of bold and comforting flavours.

Bosco says that he wanted to create a space where people could enjoy great food, drinks, and a homely lively vibe. And he did just that! The laid-back ambience of the gastropub brings back the fun of Mumbai’s streets in Al Barsha Dubai. 

So, go and visit the 59 Street gastropub in Al Barsha and get transported to the streets of Mumbai without leaving stepping a foot from Dubai!

Where : Donatello Hotel,Al Barsha When: 12 pm to 3 am Cost: AED100-150

Cover Image Courtesy: Press Release

For more such snackable content, interesting discoveries and the latest updates on food, travel and experiences in your city, download the Curly Tales App. Download HERE .

Join The # CT Squad!

Sign up for our daily email and get the best delivered straight to your inbox. We pinky promise to make it awesome!

15 Best Desert Safaris in Dubai You Can’t Go Wrong With

It’s sleek and modern but Dubai is hiding an abundance of heritage beneath those shiny skyscrapers, malls, and luxury hotels. A short journey into the United Arab Emirates inland and you’ll find swathes of red sand dunes that gift you with rip-roaring adrenaline pursuits, exotic desert wildlife, and a glimpse into traditional Bedouin culture.

The most exciting way to experience this sprawling desert-scape for yourself is to book a safari tour in Dubai!

If you’ve already read my 4 days in Dubai itinerary then perhaps you’re already feeling inspired to tap on your own trip to the Dubai desert. Now, to help you make that dream reality, I’ve rounded up the best desert safaris in Dubai that you can book right now!

* Disclosure: This post contains a few affiliate links, which means I may receive a small commission, at no cost to you, if you make a purchase through my link. *

Table of Contents

Quick Lockdown of the Best Dubai Desert Safaris

Whether you want to take the backseat or grab the reins and drive your own quad bike or dune buggy, I’ve rounded up the most popular, most adventurous, and most unique desert safari tours in Dubai.

Among the safaris I have collated, you will find options suited for solo adventurers, couples, friends, and families. There is something for everyone to enjoy so all you have to do is pick the one that most appeals to you and press ‘book’! 

MY TOP 5 PICKS FOR THE BEST DESERT SAFARIS IN DUBAI

• Overall Best Dubai Desert Tour: Premium Red Dunes, Camel Safari, & BBQ at Al Khayma
• Most Budget-Friendly Safari Tour in Dubai: Morning Desert Safari with Sandboarding & Camel Ride
• Most Luxurious Desert Safari Tour in Dubai: Dubai Private Night Safari & Astronomy
• Most Adventurous Dubai Desert Safari: Hot Air Balloon, Desert Safari, Quad Biking, and More
• Best Overnight Dubai Desert Tour: Red Dunes and Camel Safari with Overnight Camp

Keep reading to know more about each tour and to find some more desert safaris in Dubai to choose from!

15 Best Desert Safaris in Dubai

A quick note to say that most tours include pick up and drop off from your hotel or a chosen location in central Dubai. I have specified any exceptions to this rule. Your pick-up time is generally an hour before the tour start time. The exact time will be communicated with you at the time of booking.

Do check the terms carefully to ensure that the area where you stay in Dubai is covered in the transfer service. Bear in mind that religious holidays such as Ramadan do affect certain elements of the tours such as the cultural performances and dances. 

Hold onto your hat, now for the full desert safari guide! 

Most Popular Desert Safaris in Dubai

The following 5 listings are the most popular desert safari tours in Dubai based on the opinions of previous customers. These tours offer a balanced blend of adrenaline and culture and each has various additional extras if you want to personalize your tour. 

1. Dubai: Premium Red Dunes, Camel Safari, & BBQ at Al Khayma

Price range: $$ Duration: 7 hours  Meals: BBQ buffet  Highlights: Dune bashing, camel safari, sandboarding, falconry show

An excellent all-rounder tour, this desert safari takes you across the Lahbab Desert where you will experience the thrill of dune bashing. Once you’ve worked up an appetite you will be taken to the Al Khayma Desert Camp for an evening of relaxation and further activities.

A short camel ride is included in this tour and there is the option to add a second ride and feed the camels yourself. You are also invited to partake in a spread of cultural activities including henna painting, meeting the resident falcons, and watching a traditional dance performance. 

Additional add ons include the chance to go quad biking or expand the dune bashing to a longer duration. The meal included is a BBQ buffet but another upgrade gives you the choice to receive VIP table service. 

Setting the precedent for most of the tours on this list, the excursion includes your pick up and drop off from your chosen hotel by a licensed desert guide in an air-conditioned 4X4 Land Cruiser. Lasting 7 hours in total, the tour usually starts at 3 pm.

Considering the inclusions, tour duration, price point, and customizations, I consider this to be the best Dubai desert safari in terms of the overall experience. 

Customer review: “This excursion was a 10/10 experience!!! It was well worth every coin, most especially the dune bashing. Mansoor Manz was such an amazing host, if you are able to request anyone request him! He went above and beyond to make sure this experience for my family was special- the drive to the desert was accompanied with a full on tour, facts and history about the UAE, and good humor mixed in it all. This is a must book!” – Ahlam, May 2021

2. Dubai: Red Dunes Safari, Quad Bike, Camel Ride & Sand Board

Price range: $ Duration: 4 hours  Meals: None  Highlights: Dune bashing, camel safari, sandboarding 

This Dubai desert safari is essentially a condensed version of the first tour on my list. The shorter time span (and subsequent reduction in price) means that this one is ideal for those on a shorter stay in Dubai or who are on a tighter budget.

The dune bashing aspect of the safari will last around 40 minutes after which you can enjoy a short camel ride and a spot of sandboarding. If you’d rather not take part in this then you can simply relax and soak up the landscape. There are plenty of opportunities to take photos during the safari. 

Starting times vary from 8 am, 9 am or 10 am in the morning, and 3 pm in the afternoon which means that you will catch the sunset before you depart. Again, you will be collected from your hotel or desired location.

As with the first tour, this safari offers a couple of customization options. Those include upgrading from a shared tour to a private tour and adding quad biking if you wish.

However, there is no inclusion for food with this excursion so ensure that you eat well prior to leaving and pack some snacks to keep your energy levels up.

Customer review: “This tour was exactly what we paid for! Nabeel, our tour guide, was great with pictures and super fun in the safari ride! He was very attentive and communicative. The camel ride was amazing and I was happy that the camels look cared for. Would recommend this to anyone looking for a desert experience.” – Paola, April 2021

3. The Sunriser: 4-Hour Sunrise Safari from Dubai

Price range: $$ Duration: 4 hours  Meals: Breakfast picnic  Highlights: Sunrise in the desert, falcon show

If you’ve ever fantasized about witnessing the sunrise above the Arabian Desert, then this is the best Dubai desert safari for you.

Once you’ve got the early pick-up out of the way (don’t worry, you can snooze in the car) your licensed guide will whisk you away to the remote sand dunes where you will watch the horizon glow with the first rays of sunshine. 

As the sun makes its final ascent you will be invited to take your seat for an Arabian breakfast picnic while you watch the falcon show. There will be plenty of time to ask questions about the desert lifestyle and customs, and you will gain heaps of trivia about the birds of prey during this tour.

This option is perfect for the culturally curious and those with an interest in wildlife – and early birds, it goes without saying. 

This sunrise safari is perfect for bucket listers, photographers, and couples seeking one of the most romantic activities that the UAE can provide. But please note that this tour does not include dune bashing or any other extreme activities. The tour starts at 4.45 am, which means pick up is around 4 am. 

Customer review: “We were picked up from the port on time. The guides prepared a great breakfast for us in the desert and we could calmly wait for the sunrise. Even if the falcon show was a typical tour program, it really fascinated us. However, this only took about 10 minutes. Dune bashing with the pick ups was also a lot of fun and we can only recommend the trip!” – Theresa, December 2019

4. Dubai: Morning Desert Safari with Sandboarding & Camel Ride

Price range: $ Duration: 4 hours  Meals: Light snacks or brunch (optional) Highlights: Dune bashing, camel safari, sandboarding 

If sunrise is pushing you too far out of your comfort zone then how about a more leisurely safari with the option to add brunch? This desert safari combines the rush of dune bashing and sandboarding in the Dubai desert with the opportunity to experience the landscape in tranquility before the afternoon tours arrive. 

Once you’ve had your fill of adrenaline your guide will take you to Al Khayma where you will be greeted with traditional Arabic coffee (Gahwa), dates, and other sweets. Once at the camp you will have the chance to meet and ride the local camels and learn about the Bedouin way of life.

If you want to indulge in the traditional Arabian brunch then this will take place upon completion of the safari quest, at Al Khayma Heritage House in the Al Fahidi Historical District. 

This safari offers four morning start times of 7.30 am, 8 am, 9 am, and 10 am. However, there is also the opportunity to book an afternoon slot at 3 pm or 3.45 pm which will conclude with golden hour. Again there is the option to add quad biking to your session.

This is the best Dubai desert safari for those on a budget who still want to experience a bit of everything. For those seeking luxury, you can select the private tour version of this excursion. 

Customer review: “Bash, our guide picked us up right on time, then he drove us to the desert and during the ride he showed us some attractions and told us about the history. Sand duning was fun but you shouldn’t do it if you have motion sickness. Sand boarding and the camel ride were a nice experience, would definitely recommend!” – Sarah, April 2021

5. From Dubai: Red Dunes and Camel Safari with Overnight Camp

Price range: $$ Duration: 17 hours  Meals: Light snacks, BBQ buffet, breakfast  Highlights: Dune bashing, sandboarding, camel safari, camping overnight in the desert, sunset, and sunrise 

Now that you’re all warmed up with the first couple of tours, how about upgrading your desert safari to a camping adventure? Surely the most immersive safari tour in Dubai, this option gives you the chance to live the real desert life by spending a night in a Bedouin tent!

Following your hotel collection, you will journey to the desert and enjoy a sequence of dune bashing, sandboarding, and camel riding. If you so wish you can also add quad biking at this stage for an additional fee.

After all the excitement you will be offered Gaymat (Arabic sweets) and Chai (Arabic tea) before making yourself comfortable to observe the sunset in the camp. 

You will spend the night sleeping in a Nawar, a Bedouin-style bed housed within a tent, beneath a quilt of stars. But before you hit the hay you will share a BBQ feast while you watch Tanoura dancing and belly dancing displays.

There is also the option to smoke shisha and meet the resident falcons, and ladies may participate in henna painting.

You will start your second day by rising early to undertake a camel trek through the dunes to the nearby sunrise spot. Before returning to Dubai bright and early, you will tuck into a freshly cooked Arabian breakfast. The tour starts at 3.30 pm and is excellent value for what you receive. 

Customer review: “Unbelievable from start to finish. I was with the team leader Rav, and he just crushed the dune bashing. The camp in the desert was lovely, the bed and tent they had prepared too. MUST DO in Dubai, like seriously. Worth all your money….. And more!” – William, May 2021

Best Dubai Desert Safaris for Adrenaline Junkies

Did the first 5 tours pique your interest, but would you say you’re a self-confessed daredevil seeking something even more adventurous? In that case, I’m sure one of the following desert safari tours in Dubai for adrenaline junkies will satisfy your thirst for thrills!

6. Dubai Evening Desert Quad Bike Adventure and BBQ Dinner

Price range: $$ Duration: 7 hours  Meals: BBQ buffet Highlights: Quad biking, Tanoura and belly dancing show

Hang on tight, very tight, this exhilarating desert safari invites you to rev up and tackle the dunes yourself on the back of your own quad bike.

Prior to starting the Dubai desert tour, you will receive a comprehensive safety briefing about how to drive and control your vehicle. Your professional guide will then embark across the red dunes as you follow courageously in their stead. Each quad bike is designed to carry one rider, there is no option to ride pillion. 

After exhausting yourself with this high octane activity you will be presented with a shisha and Arabic-style BBQ dinner. For entertainment, you can look forward to a cultural display of Tanoura and belly dancing. There is also the opportunity to enjoy a brief camel ride in between relaxing in the camp. 

The tour starts at 3.15 pm and comes as both a shared tour and the possibility to upgrade to a private tour. 

Customer review: “Karnain was great! He was a great driver and very informative. As we were driving to our location he made great suggestions on what to do while in Dubai on vacation. He took very nice pictures and videos and took our safety seriously. I would definitely want him as a driver again!” – Alexis, May 2021

7. Dubai Evening Dune Buggy and BBQ Desert Adventure 

Price range: $$$ Duration: 7 hours  Meals: BBQ  Highlights: Dune buggy experience, sandboarding, Tanura and belly dancing show

If quad biking isn’t for you but you’re looking for a more daring way to experience the Dubai desert then a dune buggy is the perfect compromise. This desert safari provides two-seater buggies so you can buddy up with your travel mate or go solo.

Safety is paramount and each buggy is equipped with a full roll cage and a full safety harness. Before your guide unleashes you on the dunes they will provide a full safety briefing to give you the confidence to tackle the giant dunes. 

The dune buggy expedition lasts one hour after which you will disembark at the desert camp and feast on a lavish desert BBQ while the sun sinks into the horizon. Make sure you grab the opportunity to surf down the dunes before the desert is plunged into twilight.

You will spend the rest of your excursion being entertained by an Arabian dance performance and sharing stories with the desert residents. Female guests may have a customary henna tattoo, the perfect souvenir of a wonderful Dubai desert tour. 

The starting time for this tour is 3.15 pm. Children are welcome on this tour but those younger than 18 must be accompanied by an adult. 

Customer review: “The excursion was perfect, the activities offered as well as the dinner with shows really lived up to our expectations! Special mention for our guide Niaz who was really brilliant, caring and great advice. I highly recommend this excursion and especially this guide which will make you enjoy your stay in Dubai in the most beautiful way.” – Nicolas, January 2021

8. Dubai: Self-drive Guided Desert Adventure by 4WD Dune Buggy 

Price range: $$$ Duration: 1-2 hours  Meals: None Highlights: Self-driving your own customized dune buggy

Cranking up the volume a notch, this tour invites you to take charge of your own Polaris XP 1000 customized 4WD dune buggy. Pay attention while making your reservation as there are several variations available to suit your requirements.

For example, you may choose a one-seater, two-seater, or even a four-seater if you wish to turn this into a family bonding experience! You also have the option of a one or two-hour experience. 

From behind the wheel, you will explore the most breathtaking desert and mountain areas in the whole of the UAE, such as Big Red, Pink Rock, and Fossil Rock. The buggies are top-notch and you will be fully kitted out with a helmet, goggles, and gloves. 

Children from age 10 are permitted to ride in the buggy but the minimum age to drive the vehicle is 15. You must take your passports or ID in order to proceed with this hair-raising tour. Tour start times are typically 6.30 am, 7.30 am, 8.30 am, 3.30 pm, 5 pm and 5.30 pm depending on the selected tour.

Customer review: “If you’re into driving then just go for it. The buggies are powerful and fun to drive, it’s not that cheap Chinese buggy you can rent as a tourist in other places. I had Jamie and Adriaan as guides and they did a great job. I’d recommend two hours tour and no passenger, so you can enjoy all of it yourself.” – Alexander, April 2019

9. Dubai: Self-drive 2000cc Ranger-Dune Buggy

Price range: $$$ Duration: 4-6 hours Meals: BBQ dinner (for 6-hour tour) Highlights: 50-minute drive in a customized desert buggy 

If you want to go even faster then this spine-tingling self-drive adventure might be the best Dubai desert safari for adrenaline junkies. Your customized ‘ranger’ buggy enables you to get even closer to the dunes and feel every twist and turn as you navigate your way through the desert. 

These buggies accommodate one or two passengers so you can book this activity as either a solo driver or as a duo. The driver must be aged 16 or over and an adult over the age of 16 needs to accompany those between the age of 10 and 15. 

There are two time durations available. However, regardless of whether you book the 4 or 6-hour tour the total drive time is 50 minutes. Both tours also include the provision to try sandboarding and take a short camel ride.

The 6-hour option (starting at 3 pm) includes the cost and time for dining on a desert BBQ dinner and additional activities within the Al Khayma Camp. Only soft drinks are provided to those who opt for the 4-hour tour (starting time at 7.45/8.45 am).

Customer review: “This was one of the best experiences I have ever had! The tour had everything, a buggy ride, camel ride, falconing, henna tattoo, dance shows and barbeque dinner. The highlight was the buggy tour though, absolutely incredible feeling! Nabeel, our guide was extremely friendly and welcoming. Thank you again for such a memorable experience!” – Felix, February 2020

10. Dubai: Hot Air Balloon, Desert Safari, Quad Biking, and More

Price range: $$$ Duration: 5 hours Meals: Breakfast  Highlights: Sunrise hot air balloon flight, quad biking, camel safari 

Packing in adrenaline left, right and center, this tour starts with a sunrise hot air balloon over the dunes and concludes with quad biking and camel riding across them! 

Subject to the weather conditions your flight will last 45-60 minutes and enable you to appreciate sunrise from a whole new perspective. There’s no time for jelly legs because the second you land you will plunge straight into a thrilling quad bike ride before the bulk of the morning tours arrive.

You also have the pleasure of riding a camel and sometimes there is the option to ride a horse too. Not forgetting meeting the falcons of the traditional Bedouin camp and diving into a gourmet Arabic breakfast.

This is the best desert safari in Dubai for adrenaline junkies who want to experience the majesty of the red dunes from all angles. It’s perfect for couples and families, with children over the age of 5 permitted to take part.

There is no dune bashing in this offering however the other inclusions more than make up for it and the quad biking is automatically included at booking. 

As hot air balloon flights must depart early to beat the wind, the start time of this activity is 3 am.

Most Unique Desert Safari Tours in Dubai

For the final section of my guide to the best Dubai desert safaris, I’ve chosen 5 tours that offer something utterly unique.

The following tours are preoccupied with showcasing the heritage, culture, nature, and wildlife of the desert and sustainable tourism. None of these excursions include dune bashing but they all offer something remarkable in its place. 

11. Heritage Desert Safari from Dubai

Price range: $$$ Duration: 7 hours  Meals: Dinner Highlights: Vintage Land Rover transportation, tour of Dubai Desert Conservation Reserve, bread making experience 

This safari tour in Dubai is radically different from the others. First of all, you’ll notice that your vehicle is a vintage, open-air 1950’s Land Rover rather than a modern 4X4.

As I explained, there is no dune bashing in this tour but rather the safari focuses on the heritage of desert culture and the exotic wildlife that resides in the Dubai Desert Conservation Reserve.

This is a 225 square kilometer (87.1 square miles) natural reserve which limits the number of tour operators who are permitted to organize trips here. This means that with minimal impact on the environment you can see what the region would have looked like centuries ago. In fact, another wonderful factor about this safari tour is that a contribution is made directly to the reserve when you book your place. 

After taking an informative tour through the conversation reserve you will relax at an evocatively lit Bedouin camp and immerse yourself in activities such as camel rides, henna artistry, shisha, and befriending the falcons.

Another unique feature that this tour offers is that you will learn how to prepare a local bread recipe that has been carefully handed down through the ages. The tour starts at 2.30 pm and your booking includes your dinner beneath the stars. 

Customer review: “Fantastic from start to finish. The guides really cared about the experience they were delivering and all felt very authentic and premium. Particularly liked the awareness of sustainability of the experience by not offering dune bashing, sticking to the tracks and not using plastic bottles, rare to see in Dubai!” – Max, December 2020

12. Dubai Private Night Safari & Astronomy

Price range: $$$ Duration: 5 hours Meals: 3-course dinner Highlights: Vintage Land Rover transportation, twilight desert walk, astronomy session

If you’re waiting for me to share the best desert safari in Dubai for a romantic date night then this is the one you’ll want to surprise your other half with. Pick up for this unique night safari is 5.30 pm.  

Each booking covers two guests and you will venture into the desert after sunset in an open-top 1950’s Land Rover. After a drive through the cooling dunes, you will participate in a twilight nature walk where you might see anything from creepy crawlies to fauna.

Night vision binoculars are provided so that you can see the full might of the desert-scape and its nocturnal residents. This activity is led by a highly trained conservation guide with extensive knowledge of ecotourism and the local environment. 

In addition to the wildlife safari, you will take part in an astronomy session with a professional telescope which allows you to fully comprehend the star-studded sky. Your evening concludes with a decadent three-course dinner at an exclusive camp within the desert retreat of the local royal family. As you see, this safari oozes romance!      

Customer review: “We had the best guide ever, speaking Russian German and also English fluently!! Amazing Tour, very entertaining and interesting you get a lot of impressions about the beduines. I really recommend this tour if you like to a different view of Dubai. The food was also really tasty. we started from 6.30 pm until 12 pm, be prepared to wear comfortable shoes.” – Ngan, May 2021

13. 1 or 1.5 Hour Horseback Dubai Desert Park Ride

Price range: $$ Duration: 1-1.5 hours  Meals: None Highlights: Experience the desert by horseback, washing and tending to your horse, possibility to see native wildlife 

Giddy up, this is one of the best desert safaris in Dubai for horse lovers! You will mount your friendly horse and follow your guide through the dunes of the National Mushrif Park.

Along the way, you can keep your eyes peeled for native wildlife that resides in the region such as the desert fox. Even without spotting any fauna, the scenery is breathtaking and you can soak up nature far from the sounds of the dune bashing 4X4s and quad bikes.        

Upon conclusion of the trek, you will be invited to wash and groom your companion horse and give them a reward of carrots. The tour is best suited for those with some horse riding experience as at times you will trot and canter. 

This tour is available at 5.30 am, 6.30 am and 6 am. Please note that unlike most of the other safaris on this list, for this activity you will need to arrange your own transport to and from the horse stables.

Customer review: “Amazing experience in the nature, beautiful surrounding, great horses. All very organized and professional.” – Julia, May 2017

14. Dubai: Private Falconry Safari

Price range: $$$ Duration: 5 hours  Meals: Luxury breakfast (optional) Highlights: 1.5 hours of falcon handling, nature drive  

Designed for those with a keen interest and appreciation for birds of prey, this safari provides you with the bucket list experience of training a falcon to fly from your own wrist.

During the course of the private safari, you will also interact with an owl and an eagle. The falconry experience of the tour lasts 1.5 hours and is led by a professional falconer who is passionate and committed to taking care of the beautiful creatures. 

For the remainder of the tour, you will be able to enjoy a nature drive by 4X4 during which you will be poised to spot the likes of houbara bustards, Arabian oryx, and sand gazelles. As you can imagine, this is the best desert safari in Dubai for those who possess an eagle eye of their own! However, your qualified guide will do his/her best to help you detect the wildlife. 

As the tour starts at 5 am you may want to upgrade the experience to include a luxury breakfast. At least two participants are required to book this unique tour. 

Customer review: “Wonderfully personal experience among the untouched dunes of the Desert Conservation Reserve: for nature lovers interested in learning about falconry and the flora and fauna of the Arabian Peninsula, this tour offers an authentic, hands-on experience with a knowledgeable guide. Rather than watching birds being flown, you become a trainer yourself and get a taste of how various birds of prey hunt and form working bonds with falconers. Worth the extra Money.” – Viktoria, December 2019

15. Dubai Desert Conservation Reserve 5-Hour Tour with Breakfast

Price range: $$ Duration: 5 hours  Meals: Breakfast  Highlights: Chance to spot native wildlife, expert knowledge from conservationists 

For the final tour on my list, you will head deep into the Dubai Desert Conservation Reserve. As you observe the likes of native birdlife, Arabian Oryx, desert monitors, and free-roaming gazelles, your safari guide will nourish your exploration with a wealth of knowledge about the flora, fauna, and history of the first national park in the United Arab Emirates.

It’s not guaranteed but if you’re really lucky you might even catch a glimpse of the rarely sighted Gordon’s wildcat.

Children over the age of 10 are welcome on this tour and it’s the perfect activity for solo wanderers, families, or couples alike. The start time for this tour is a languid 7.30 am and it concludes with a decadent breakfast at the Al Maha Desert Resort before you return to the city.  

Customer review: “One of the highlights of our visit to Dubai, our driver and guide, Peter, was an accomplished naturalist. He quickly picked up on our interest in birds and wildlife and we had some great views of oryx, two species of gazelle, numerous LBJ’s and fine views of a Pallid Harrier, all from the comfort of a splendid silver Range Rover. The desert landscapes are spectacular and the stop for a relaxed breakfast was a welcome break at the unexpectedly luxurious Al Maha “desert resort”.” – Philip, December 2020

Useful Info for Planning Your Trip to Dubai

Where to stay in dubai.

There is no shortage of places to stay in Dubai, from high-end luxury hotels to more affordable options. Contrary to belief, you can find good deals on hotels in Dubai, no matter your budget.

The most important thing to keep in mind when booking your hotel room is the location. Dubai is huge and spread out, so you want to make sure you’re staying in an area that’s close to the sights and attractions you want to see.

Generally speaking, here are the best areas to stay in Dubai:

Deira – If you’re looking for a more traditional Arabic experience, you can’t go wrong with Deira. It’s also one of the more affordable areas in Dubai.

Bur Dubai – This is a great option if you want to be close to the action. Bur Dubai is home to many of the city’s best hotels, restaurants, and nightlife venues.

Palm Jumeirah – If you’re looking for a luxurious and relaxing vacation, look no further than Palm Jumeirah. This artificial island is home to some of Dubai’s most exclusive hotels and resorts.

Downtown Dubai – This is the best area for those who want to be close to the city’s most popular attractions, like the Burj Khalifa and the Dubai Mall.

Dubai Marina – This is a great option if you’re looking for a more laid-back atmosphere. The Dubai Marina is home to many restaurants and bars, as well as a beautiful waterfront promenade.

In case you’re curious to know more about each area with pros and cons and hotel recommendations, make sure to check out my in-depth article about  where to stay in Dubai .

If you want to make your Dubai trip even more memorable, read my post about the best hotels in Dubai with Burj Khalifa views !

If you’re in a hurry, here are my top recommendations for different budgets.

• Luxury: Atlantis the Palm
• Mid-Range: Crowne Plaza Dubai Marina
• Budget: Gulf Inn Hotel Al Nasr

How to get to Dubai

Being the biggest hub between Europe and Asia and one of the busiest airports in the world, Dubai International Airport (DXB) welcomes a huge number of airlines and connects the city with the rest of the world.

Located only 15 km (9.3 miles) from Downtown Dubai, flying to DXB is the most convenient way to get to the city. Once you land, there are several ways to get into the city center: you can take a taxi, the metro, or even the bus.

Although DXB is the biggest airport in Dubai, you can also choose to fly to Al Maktoum International Airport (DWC). This airport is located in the Jebel Ali area, about 50 km (31 miles) from Downtown Dubai, and it mostly handles cargo flights and low-cost carriers.

How to get around in Dubai

Dubai is an enormous city and getting around can be a bit daunting, especially if you’re not used to such big metropolises. The good news is that there are plenty of options when it comes to transportation.

Public transportation – Dubai has both metro and public bus systems in place. Although the metro is the most efficient way to get around, it only covers certain areas of the city. The bus system, on the other hand, covers a larger area but it can be quite slow during rush hour. This is definitely the cheapest way to get around Dubai, however, it can be pretty time-consuming.

Taxis – Taxis are widely available in Dubai and they’re relatively affordable, especially if you’re splitting the fare with someone. Your best bet is downloading the Careem app, which is similar to Uber, and lets you order a traditional Dubai taxi or a private vehicle.

Car rental – If you want the freedom to explore Dubai at your own pace, then renting a car is the way to go. Just keep in mind that traffic can be pretty bad during rush hour, so you might want to avoid driving during those times.

Best time to visit Dubai

The best time to visit Dubai is between November and March when the weather is cooler and more bearable. This is also the peak tourist season, so you can expect higher prices and bigger crowds.

If you don’t mind the heat, then you can visit Dubai during the summer months (June to August), when temperatures can reach up to 40°C (104°F). Each and every place is air-conditioned in Dubai, so you can take refuge from the heat indoors.

Just keep in mind that outdoor attractions such as gardens and water parks will be much less enjoyable during this time and it’s practically impossible to swim in the ocean because of the high temperatures.

If you want to avoid the crowds and get cheaper rates, then April, May, September, and October are the best months to visit Dubai. Prices will be lower and the weather will still be relatively pleasant.

Another thing to keep in mind: Ramadan takes place during the ninth month of the Islamic calendar but the exact dates change every year (usually it falls between March and May).

During this time, Muslims fast from dawn to dusk and many restaurants and cafes will be closed during the day. Alcohol is also not served during Ramadan. However, nightlife carries on as usual and many hotels offer special rates during this period.

If you’re not Muslim, then you can still visit Dubai during Ramadan, you just need to be respectful of the local customs and traditions.

Planning a trip to the UAE?

Then you might want to take a look at all our other travel guides about the United Arab Emirates. I promise, they are just as awesome as this article was!

• Top 10 Best Areas to Stay in Dubai
• 23 Incredible Dubai Hotels with Burj Khalifa View
• How to Spend 4 Days in Dubai: The Perfect Dubai Itinerary
• 24 Most Beautiful Instagrammable Places in Dubai
• 15 Best Desert Safaris in Dubai You Can’t Go Wrong With
• 88 Best Dubai Quotes & Dubai Captions for Instagram
• Hotel Review: Fairmont The Palm, Dubai
• Hotel Review: Th8 Palm, Dubai
• Where to Stay in Abu Dhabi: 7 Best Areas & Hotels
• How to See the Best of Abu Dhabi in One Day
• 7 Epic Instagrammable Places in Abu Dhabi You Can’t Miss
• Hotel Review: Shangri-La Qaryat Al Beri, Abu Dhabi
• Hotel Review: The Ritz-Carlton Abu Dhabi, Grand Canal

Pin It for Later!

Leave a Comment Cancel reply

You can unsubscribe at any time. Please see our Privacy Policy .

COUNTRYPICKERWESELECTEDHEADERMESSAGE

COUNTRYPICKERWESELECTEDMESSAGE click here

Choose your country and language

• The Americas
• The Middle East
• Asia & South Pacific
• All Inclusive Offers
• Athens Vacations
• Early bird offers

Dubai Vacations

• Indian Ocean Vacations
• Last Minute Escapes
• Maldives Vacations
• Milan Vacations
• Upgrades & More

Featured Destinations

Middle east.

• Ras Al Khaimah

Indian Ocean

• Philippines
• South Korea
• South Africa
• All-Inclusive Vacations
• Beach Vacations
• City Breaks
• Business Class Vacations
• Family Vacations.
• Romantic Getaways
• Ultimate Luxury
• Egypt - Splendours of the Nile
• India - Golden Triangle Tour
• Italy Tours
• Jordan - Jordan Explorer Tour
• South East Asia
• Sri Lanka - Serendib Explorer
• Pay My Balance
• 1-855-358-1505
• Flight + Hotel

Search Holidays

• Manage Booking

More than 9 Rooms

Home to an iconic skyline, miles of pristine beaches, family friendly water and theme parks, and world-class shopping, Dubai is a buzzing city that has something for everyone. A short drive out from the city opens up a world of outdoor and sports activities including **helicopter rides, hot air balloons, desert safaris and camping, dhow cruises, kayaking and more .

Book today and enjoy guaranteed savings, limited-time super low deposit from just USD 2 per person, complimentary upgrades and many more extras to make your next vacation truly unforgettable. Simply view our Dubai vacation offers below or call our destination specialists on 1-855-358-1505 for further details and to book.

• 20% discount in selective Food and Beverage

Grand Hyatt Dubai, UAE

• 5 nights from $1,089pp
• Breakfast included
• Complimentary stay for kids
• Early booking savings on stay
• Additional skywards miles
• All taxes and surcharges included
• Round-trip Emirates Economy Class flights from New York (JFK)
• Price based on 2 adults and 1 child

Supplements may apply for other departure airports. Valid for new bookings only and subject to availability.

JW Marriott Marquis, Dubai, UAE

• 5 nights from $1,239pp
• Deluxe Room
• Additional Skywards Miles
• Price based on 2 adults and 1 child Supplements may apply for other departure airports. Valid for new bookings only and subject to availability.

• Savings on stay

Marriott Resort Palm Jumeirah, Dubai, UAE

• Palm Deluxe Two Double/Queen
• 15% discount on Spa Treatment

Waldorf Astoria Dubai Palm Jumeirah, UAE

• 5 nights from $1,329pp
• Superior Room

Hotel Riu, Dubai, UAE

• 5 nights from $1,685pp
• All-inclusive
• Double Room Partial Sea View
• All taxes and surcharges
• Return Emirates Economy Class flights from New York (JFK)

20% savings on stay

Al maha, a luxury collection desert resort & spa, dubai, uae.

• 5 nights from $5,305pp
• Bedouin Suite
• Breakfast, lunch and dinner included
• Features a private pool and its own deck with stunning views of the desert
• Complimentary Dune Dining Experience for 2 adults
• Round-trip Emirates economy class flights from Miami (MIA)

*Children under 12 are not permitted at the resort

Explore Dubai

Dubai Beach vacations

Dubai Family Vacations

Downtown Dubai

Join the emirates vacations community.

Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.

We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.

Why Emirates Vacations?

• Personalised holidays
• Support at every step
• Get more for your money
• Fly Better with Emirates

For more information, please click here

• Recent Hotels 0 You do not have any recently viewed hotels.
• Shortlist 0 Your hotel shortlist is empty!
• Recent Searches You do not have any recent searches

Please refresh this page

This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.

• Personal Finance
• Today's Paper
• Partner Content
• Web Stories
• Entertainment
• Social Viral

Indians can get UAE visa-on-arrival if they hold Schengen, US, UK visa

To qualify for the visa-on-arrival, passports must be valid for at least six months from the date of entry into the uae.

Abu Dhabi, UAE (Photo: Shutterstock)

Listen to This Article

Click here to connect with us on WhatsApp

More From This Section

Now parents can claim TCS credits for children's foreign education

How to plan your finances for Dhanteras?

Housing sales in tier 2 cities down 13%, Bhubaneshwar sees worst decline

At 5,253 Cr Pune's stamp duty collections jump 38% in nine months of 2024

'Choose France Tour 2024': A chance for Indian students to study in Europe

Dubai vs Sharjah and Abu Dhabi: Rent, living costs, pros & cons explained

Proposal to reshape India's money-changing industry hits a roadblock

Festival offers on home loans: Avoid teaser rates that reset after months

Limit small and medium reit exposure at 5% till they develop track record.

Tax dept simplifies compounding offence process with lower penalties

Don't miss the most important news and views of the day. Get them on our Telegram channel

First Published: Oct 21 2024 | 5:27 PM IST

Explore News

• Suzlon Energy Share Price Adani Enterprises Share Price Adani Power Share Price IRFC Share Price Tata Motors Share Price Tata Steel Share Price Yes Bank Share Price Infosys Share Price SBI Share Price Reliance shares
• Latest News Company News Market News India News Politics News Cricket News Personal Finance Technology News World News Industry News Education News Opinion Shows Economy News Lifestyle News Health News
• Today's Paper About Us T&C Privacy Policy Cookie Policy Disclaimer Investor Communication GST registration number List Compliance Contact Us Advertise with Us Sitemap Subscribe Careers BS Apps
• ICC T20 World Cup 2024 Business Standard at 50 IPO News October Full Moon Day 2024 Haryana Elections Results 2024 ICC Women's T20 World Cup 2024

Dubai Tours

Discover 8869 tours and activities in Dubai

Day trips & Excursions

Outdoor, Adventure & Sports

Sightseeing

Food & Wine Experiences

Theme Parks

Attractions

Transfers & Transports

Shows, Music & Nightlife

Multi day trips

Shopping & Fashion

Burj Khalifa

Dubai Frame

The View at the Palm

Burj Al Arab Hotel

Blue Mosque

Sky Views Observatory

Desert Safari

Sheikh Zayed Grand Mosque

Al Khayma Camp

Louvre Abu Dhabi

East Coast & Fujairah

Sharjah City

Fjords of Musandam

Hatta Valley

Heritage Village

Private tours.

Camel Riding

Sandboarding

Dune Bashing

Buggy Tours

Helicopter Tours

Speedboat Cruise

Hot Air Balloon Rides

Scuba diving

Gyrocopter Tours

Parasailing

Surf Lessons

Fishing Trips

Indoor Skydiving

Hummer Safari

Escape Rooms

Dolphin Watching

Paragliding

Horse Riding

Wakeboarding

Stand up paddleboarding

AYA Universe

Museum of the Future

Museum of Illusions

3D World Selfie Museum

Al Shindagha Museum

Etihad Museum

Dubai Museum

The 10 best dubai tours, dubai desert safari.

One of the most quintessential Dubai tours is a desert safari, taking you far from the glittering city lights. This is your chance to experience a slice of true wilderness, with sand stretching as far as the eye can see.

You’ll bounce through the desert on a jeep tour , doing a spot of dune bashing to get the heart pumping. Keep your eyes peeled for wildlife like the Arabian oryx and sand gazelles. These adventurous excursions usually stop somewhere like Al Khayma Camp for a smorgasbord of activities such as sandboarding , camel riding , and falconry . You will return to Dubai after a traditional desert feast.

Burj Khalifa Tour

You can’t leave Dubai without visiting the tallest building in the world! At 2,723 feet, the Burj Khalifa undoubtedly has the best views in town from its observation deck on the 125 th floor. You can ascend the tower and see the whole of Dubai sprawling below so don’t forget your camera! Head up to the outdoor terrace on level 148 for even more jaw-dropping panoramas before taking the elevator back down.

For the ultimate Burj Khalifa experience, visit at sunset to see the city come to life in the golden rays. Or, to avoid the crowds, early mornings are best.

Dhow Cruise in Dubai Marina

Dhows are the traditional wooden boats that have been sailing up and down Dubai’s coast and creeks for years. It’s the most romantic way to travel on the water and gives a unique perspective of some of the top city sights.

For the best views, enjoy a cruise along Dubai Marina , which is surrounded by futuristic architecture and sleek superyachts. This is a place where the old-world rubs shoulders with modern-day life, creating an intoxicating experience that you won’t find anywhere else. Some tours put on dinner and entertainment to take your journey to the next level.

Dubai City Tours

Dubai tours come in all shapes and sizes, with the most popular ones concentrating on some of the city’s major landmarks. You’ll learn about the history of Dubai from your expert local guide as you visit all those places you’ve heard about in the guidebooks.

In modern Dubai, you will discover gems like the Burj Al Arab, Dubai Frame , and the Atlantis Hotel, with plenty of photo stops at each. Over in old Dubai, it’s time for the souks, where gold and spices are the stars of the show. The final touches are the beautiful Blue Mosque and the Al Khayma Heritage House.

Quad Biking & ATV Tours in Dubai

Head off into the desert for a day of adrenaline and adventure on a thrilling Dubai quad biking tour. You’ll experience the magic of the wild on an intimate level and get a taste for life on safari. After a comfortable transfer in an air-conditioned vehicle, it’s time to pull on your helmet and prepare for a rip-roaring ride.

For wildlife spotting and breathtaking scenery, choose a morning ATV excursion, and make the most of the cooler temperatures. Meanwhile, if you’d like to include dinner under the stars while watching traditional Emirati belly dancing, then the evening jaunts are just the ticket.

Camel Riding Tours

If there’s one thing that every visitor to Dubai wants to do, it’s camel riding. The city is a desert oasis after all! Don’t worry if you haven’t tried it before, once you’re onboard your trusty mount, all you need to do is sit back and enjoy the views.

These fun Dubai tours are all about enjoying fresh air and tranquility as you plod silently through the sandy sea. Rolling dunes and hardy wildlife often feature, and on some trips, you’ll get to visit a traditional Bedouin camp for coffee and a meal. Opt for the sunrise ride for a cooler desert experience.

Abu Dhabi Tours from Dubai

Abu Dhabi is just 150 kilometers south of Dubai, so if you have a day to spare, it’s well worth paying a visit to the capital of the United Arab Emirates. The skyscrapers here are just as sparkly as the ones in Dubai, but the city feels a little more authentic than its glamorous sister.

On your day tour you’ll explore the magnificent marble halls of the Sheikh Zayed Grand Mosque and see the flamboyant Presidential Palace of Qsar Al Watan . Other highlights include ancient artwork in the Louvre Museum and theme park thrills at Yas Waterworld and Warner Bros. World .

Hot Air Balloon Rides over Dubai Desert

There’s no better way to appreciate the desert than by taking a hot air balloon flight over the sea of sand (although helicopter tours are a close second!). These epic Dubai tours will show you just how vast the wilderness is, with the dunes looking like tiny waves far down below.

You’ll start out early in the morning to catch the sunrise flooding the desert, before drifting silently overhead. Wildlife is often spotted at this time of day, so keep an eye out for gazelles and camels. Back down on earth, you’ll enjoy a tasty breakfast before heading back to the city.

Theme Parks & Aquariums

When it comes to theme parks and wildlife attractions in Dubai, there’s something different for every day of the month! Top pics include the Dubai Aquarium and Underwater Zoo , where you can come face to face with creatures of the deep. The whole family can plunge down slides at the Atlantis Aquaventure Waterpark or meet their cartoon heroes at IMG Worlds of Adventure .

Back on dry land, adrenaline junkies will love visiting Ferrari World and Ski Dubai for some seriously speedy thrills. Or, for something a bit more relaxing, head to Miracle Garden for out-of-this-world floral displays and fairytale castles.

Looking for more tours?

Planning your visit to dubai, about dubai.

The glittering city in the desert has rapidly grown to be one of the most popular city break destinations in the world. Towering skyscrapers, boundless adrenaline activities, and luxury hotels in Dubai all combine to offer a vacation like no other.

Dining and entertainment are world-class, with cultural influences from around the globe. Attractions are reliably top of the range, with innovation and technology at the core of everything the city does. Yet beneath the gloss, you’ll also discover a rich local history as you enjoy one of the many Dubai tours that lift the lid on this ambitious urban oasis.

Good to know before arriving

The easiest and most efficient way of navigating the sprawling Dubai metropolis is by taxi which can be hailed on the street or arranged through your hotel. For shorter, central journeys the Dubai Metro is also a good option. Taking a hop-on hop-off bus tour around Dubai is a fun introduction to the city, with some great views from the top deck.

If it’s your first visit, we recommend booking a hotel in Dubai Creek, Downtown, or Dubai Marina for easy access to the main sights. Staying a few days? Then get a Dubai Explorer Pass for discounts on multiple attractions and Dubai tours.

Places and experiences that cannot be missed

Once you’ve had your fill of the iconic sights like Palm Jumeirah, the Burj Khalifa, and the Marina on the must-do Dubai tours, it’s time to explore a little deeper. Take a walking excursion around the old city to discover the real Dubai then enjoy a dinner cruise or food tour to learn about local cuisine. For a change of scenery, book a day trip to the Hatta Valley , Al Ain , or the dramatic Fjords of Musandam .

Dubai isn’t known for being cheap, but there are plenty of free things to do, including strolling around the Gold and Spice Souks and visiting the Camel Museum.

Explore More

Best places to visit in dubai, tours and things to do in dubai, best day trips from dubai.